Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Synonym

Accession Q6P2S7 Q05DD4 TPR repeat protein 41
Symbols GNN
GNNP

Gene

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MSQKTNENVERYTQFLQKPQKPIQPYICSTLNDFQEERDFLANNIFPQLNELCNSWGTYFKAVDLSWSAL      1 - 70
KAPKSLPTHLFRQYSCLRSQRLKLCLDYVNSCFPFFICMLGQTYGDFLPDYSHFMTSKVTRLSSLSKVEN     71 - 140
LYVAAKNGYPWVLENPSCSLTEFEIIQAAFLNESQFQYFYFRTGTTLLKALDDEKKGERLPSSSSTNEEE    141 - 210
TLRIGKLKAKIISKGLPVRFYSDLHELGELVFKDWSVVIEKLHPATLMIENIDYKHSFERFYHEEFTEKC    211 - 280
KQMCVISKESDRTFEILEKFALKDVELDFNNVAADSSLDSVPRFFRINPTPTYKSILLLSREHGCGKSTL    281 - 350
IANWVNYFKKKHPSMLLIPHFVGSTCESSYIMSVIHYFITELQYRNYGTQLETDILNEDSDGLVFSFLVE    351 - 420
VFIASISLKPCILVLDGIEELIGIYGISGQKVKDFSWLPHSLSPHCKFIMSTVSSSLSYKSLCARPDVRT    421 - 490
VELISTGDEETKLNIFRKHLSIPMMDPFEQSTQALRKKPDLSPLKLTILANELKEYRINHNEFQCMKEYL    491 - 560
EAVSVQELWELVLKRWIEDYSWTFQPKRANSDTVASGEGLDSWVADALCLLCLSHGGLAEDELLQLLDML    561 - 630
GYRNHYKVTALHWAAFRNATKQWVQEKPNGLLYFWHQSLSAVEHKLLGVITPVESSPCSFQTPMNHKKTH    631 - 700
FHQVLIRYFQRQTSFWRVYQELPWHMKMSGCLRGLCGFLSSPTITDFISKIQSLGFWTRLHLIHFWNVLL    701 - 770
EAGYDVSEAYLLSVAKIKADQCHTMRKSGTLSVLQCRLIELTVLDKCRLMFFIGSFLKFMGKTNEAEELF    771 - 840
LSVEDMLVQSQSMTDMLLKVQNAIGELYLETGMTQEGFQYFQKAWSSMLRLSLSDLEDSRDLVKQKVRVL    841 - 910
DNLAKSASEEYLKENHILEYATEISNLLDNNPRDQATMKYIEGVLMFVAGNTSLAKMKLRECLNIRKSLF    911 - 980
GKKNMLVGEVMEFLADLLFFPQRDSKKSQRKQVLKYYKQVIKIKENAETLAKSSLLRKQLSISLSDTLCK    981 - 1050
LAGHLLASDSCHHVMIEAVGYLYRSVDLRVIHLGSSHSSIHGIHGILHLLREIEWIRSRRYWPQGMSQQH   1051 - 1120
SEGSRNGFSLWEHLVKLNYHSAQSSNTVSSAMCMNADKLHRARRMDLAPQTISDKSKCAPGKGKKKPIIC   1121 - 1190
ISAEEKIQRKTQNNAEIWNGSGKEASKKKTDYSSNILSLGKMNGLIKLSRQRILLAKSESGEGEITTIYH   1191 - 1260
HPLPWPVSTKNPGESEFISEKWLFHSPDYISISQKSFLQRRLHIETKLLKTSNDINKE               1261 - 1318
//

Text Mined References (5)

PMID Year Title
21626137 2011 Two-marker association tests yield new disease associations for coronary artery disease and hypertension.
16541075 2006 The finished DNA sequence of human chromosome 12.
15827139 2005 The common viral insertion site Evi12 is located in the 5'-noncoding region of Gnn, a novel gene with enhanced expression in two subclasses of human acute myeloid leukemia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.