Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.89
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
adrenocortical carcinoma -2.208 0.000
tuberculosis -1.600 0.000
ovarian cancer -1.100 0.000

Gene RIF (3)

PMID Text
25979344 Although amino acid substitutions of residues surrounding Arg-508 had no great effect on PRMT9 recognition of SF3B2, moving the arginine residue within this sequence abolished methylation.
25799006 The decrease in PRMT10 was canceled by knockdown of AR or an AR antagonist. These results indicate that PRMT10 plays an important role in androgen-dependent proliferation of prostate cancer cells
25737013 PRMT9 is a type II methyltransferase that methylates the splicing factor SAP145.

AA Sequence

MSNSRPRSRRDAGGGAGAAGRDELVSRSLQSAEHCLGVQDFGTAYAHYLLVLSLAPELKHDVKETFQYTL      1 - 70
FRWAEELDALSRIQDLLGCYEQALELFPDDEVICNSMGEHLFRMGFRDEAAGYFHKAVKLNPDFSDAKEN     71 - 140
FYRVANWLVERWHFIMLNDTKRNTIYNAAIQKAVCLGSKSVLDIGAGTGILSMFAKKAGAHSVYACELSK    141 - 210
TMYELACDVVAANKMEAGIKLLHTKSLDIEIPKHIPERVSLVVTETVDAGLFGEGIVESLIHAWEHLLLQ    211 - 280
PKTKGESANCEKYGKVIPASAVIFGMAVECAEIRRHHRVGIKDIAGIHLPTNVKFQSPAYSSVDTEETIE    281 - 350
PYTTEKMSRVPGGYLALTECFEIMTVDFNNLQELKSLATKKPDKIGIPVIKEGILDAIMVWFVLQLDDEH    351 - 420
SLSTSPSEETCWEQAVYPVQDLADYWIKPGDHVMMEVSCQDCYLRIQSISVLGLECEMDVAKSFTQNKDL    421 - 490
LSLGNEAELCSALANLQTSKPDAVEQTCILESTEIALLNNIPYHEGFKMAMSKVLSSLTPEKLYQTMDTH    491 - 560
CQNEMSSGTGQSNTVQNILEPFYVLDVSEGFSVLPVIAGTLGQVKPYSSVEKDQHRIALDLISEANHFPK    561 - 630
ETLEFWLRHVEDESAMLQRPKSDKLWSIIILDVIEPSGLIQQEIMEKAAISRCLLQSGGKIFPQYVLMFG    631 - 700
LLVESQTLLEENAVQGTERTLGLNIAPFINQFQVPIRVFLDLSSLPCIPLSKPVELLRLDLMTPYLNTSN    701 - 770
REVKVYVCKSGRLTAIPFWYHMYLDEEIRLDTSSEASHWKQAAVVLDNPIQVEMGEELVLSIQHHKSNVS    771 - 840
ITVKQ                                                                     841 - 845
//

Text Mined References (11)

PMID Year Title
25979344 2015 Unique Features of Human Protein Arginine Methyltransferase 9 (PRMT9) and Its Substrate RNA Splicing Factor SF3B2.
25799006 2015 Protein arginine methyltransferase 10 is required for androgen-dependent proliferation of LNCaP prostate cancer cells.
25737013 2015 PRMT9 is a type II methyltransferase that methylates the splicing factor SAP145.
19300908 2009 The protein arginine methyltransferase family: an update about function, new perspectives and the physiological role in humans.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17708529 2007 Interplay between chromatin remodelers and protein arginine methyltransferases.
17005254 2007 Protein arginine methyltransferases: evolution and assessment of their pharmacological and therapeutic potential.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...