Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.09
PubTator Score 2.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
adrenocortical carcinoma 1428 2.7e-11
tuberculosis 2010 8.2e-08
ovarian cancer 8520 5.0e-06
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Disease Target Count Z-score Confidence
Hypertrichosis 46 3.925 2.0
spina bifida 1074 3.203 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
adrenocortical carcinoma -2.208 2.7e-11
ovarian cancer -1.100 5.0e-06
tuberculosis -1.600 8.2e-08

Gene RIF (3)

AA Sequence

MSNSRPRSRRDAGGGAGAAGRDELVSRSLQSAEHCLGVQDFGTAYAHYLLVLSLAPELKHDVKETFQYTL      1 - 70
FRWAEELDALSRIQDLLGCYEQALELFPDDEVICNSMGEHLFRMGFRDEAAGYFHKAVKLNPDFSDAKEN     71 - 140
FYRVANWLVERWHFIMLNDTKRNTIYNAAIQKAVCLGSKSVLDIGAGTGILSMFAKKAGAHSVYACELSK    141 - 210
TMYELACDVVAANKMEAGIKLLHTKSLDIEIPKHIPERVSLVVTETVDAGLFGEGIVESLIHAWEHLLLQ    211 - 280
PKTKGESANCEKYGKVIPASAVIFGMAVECAEIRRHHRVGIKDIAGIHLPTNVKFQSPAYSSVDTEETIE    281 - 350
PYTTEKMSRVPGGYLALTECFEIMTVDFNNLQELKSLATKKPDKIGIPVIKEGILDAIMVWFVLQLDDEH    351 - 420
SLSTSPSEETCWEQAVYPVQDLADYWIKPGDHVMMEVSCQDCYLRIQSISVLGLECEMDVAKSFTQNKDL    421 - 490
LSLGNEAELCSALANLQTSKPDAVEQTCILESTEIALLNNIPYHEGFKMAMSKVLSSLTPEKLYQTMDTH    491 - 560
CQNEMSSGTGQSNTVQNILEPFYVLDVSEGFSVLPVIAGTLGQVKPYSSVEKDQHRIALDLISEANHFPK    561 - 630
ETLEFWLRHVEDESAMLQRPKSDKLWSIIILDVIEPSGLIQQEIMEKAAISRCLLQSGGKIFPQYVLMFG    631 - 700
LLVESQTLLEENAVQGTERTLGLNIAPFINQFQVPIRVFLDLSSLPCIPLSKPVELLRLDLMTPYLNTSN    701 - 770
REVKVYVCKSGRLTAIPFWYHMYLDEEIRLDTSSEASHWKQAAVVLDNPIQVEMGEELVLSIQHHKSNVS    771 - 840
ITVKQ                                                                     841 - 845
//

Text Mined References (13)

PMID Year Title