Property Summary

NCBI Gene PubMed Count 10
PubMed Score 47.12
PubTator Score 7.23

Knowledge Summary

Patent (2,672)

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.400 0.002
pediatric high grade glioma -1.100 0.000
pilocytic astrocytoma -1.100 0.000
psoriasis -2.200 0.000

Gene RIF (4)

PMID Text
25773930 Pnck may be a marker of Trastuzumab resistance and possibly a therapeutic target in breast cancer.
23634203 the relationship between PNCK and prognosis in clear cell renal cell carcinoma
21325639 Pnck induces epidermal growth factor receptor degradation, most likely through perturbation of Hsp90 chaperone activity due to Hsp90 phosphorylation. Epidermal growth factor receptor degradation is coupled to proteasomal degradation of Pnck.
18562482 Pnck induces ligand-independent EGFR degradation, and it may represent an attractive therapeutic target in EGFR-regulated oncogenesis.

AA Sequence

MLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISH      1 - 70
PNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPE     71 - 140
NLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVAPELLEQKPYGKAVDVWALGVISYILLCGYP    141 - 210
PFYDESDPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALRHLWISGDTAFDRDI    211 - 280
LGSVSEQIRKNFARTHWKRAFNATSFLRHIRKLGQIPEGEGASEQGMARHSHSGLRAGQPPKW           281 - 343
//

Text Mined References (13)

PMID Year Title
25773930 2015 Pnck overexpression in HER-2 gene-amplified breast cancer causes Trastuzumab resistance through a paradoxical PTEN-mediated process.
23634203 2013 Increased expression of pregnancy up-regulated non-ubiquitous calmodulin kinase is associated with poor prognosis in clear cell renal cell carcinoma.
21325639 2011 Pnck induces ligand-independent EGFR degradation by probable perturbation of the Hsp90 chaperone complex.
18562482 2008 Pregnancy-upregulated nonubiquitous calmodulin kinase induces ligand-independent EGFR degradation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...