Property Summary

NCBI Gene PubMed Count 10
PubMed Score 82.12
PubTator Score 7.23

Knowledge Summary

Patent (2,672)

Expression

  Differential Expression (4)

Disease log2 FC p
Astrocytoma, Pilocytic -1.100 1.3e-05
ependymoma -1.400 1.7e-03
pediatric high grade glioma -1.100 1.0e-06
psoriasis -2.200 2.0e-72

Gene RIF (4)

AA Sequence

MLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKALRGKEALVENEIAVLRRISH      1 - 70
PNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGAVSYLHSLGIVHRDLKPE     71 - 140
NLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVAPELLEQKPYGKAVDVWALGVISYILLCGYP    141 - 210
PFYDESDPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQALRHLWISGDTAFDRDI    211 - 280
LGSVSEQIRKNFARTHWKRAFNATSFLRHIRKLGQIPEGEGASEQGMARHSHSGLRAGQPPKW           281 - 343
//

Text Mined References (13)

PMID Year Title