Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.14
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MLVSGRRRLLTALLQAQKWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFL      1 - 70
EQGEATLSVARRALAAQLPVLPWSEVTFLAPVTWPDKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSI     71 - 140
VGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWLTRRNGKQWLLGKT    141 - 210
FDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQSSNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTP    211 - 280
PGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV                                        281 - 314
//

Text Mined References (5)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.