Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.14
PubTator Score 0.25

Knowledge Summary

Patent

No data available

Expression

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MLVSGRRRLLTALLQAQKWPFQPSRDMRLVQFRAPHLVGPHLGLETGNGGGVINLNAFDPTLPKTMTQFL      1 - 70
EQGEATLSVARRALAAQLPVLPWSEVTFLAPVTWPDKVVCVGMNYVDHCKEQNVPVPKEPIIFSKFASSI     71 - 140
VGPYDEVVLPPQSQEVDWEVELAVVIGKKGKHIKATDAMAHVAGFTVAHDVSARDWLTRRNGKQWLLGKT    141 - 210
FDTFCPLGPALVTKDSVADPHNLKICCRVNGEVVQSSNTNQMVFKTEDLIAWVSQFVTFYPGDVILTGTP    211 - 280
PGVGVFRKPPVFLKKGDEVQCEIEELGVIINKVV                                        281 - 314
//

Text Mined References (5)

PMID Year Title