Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.71
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 1.0e-10
osteosarcoma 7950 3.0e-05
psoriasis 6694 1.1e-04
intraductal papillary-mucinous neoplasm (IPMN) 3291 2.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.100 2.4e-03
lung carcinoma 1.500 1.0e-10
osteosarcoma -1.048 3.0e-05
psoriasis 1.800 1.1e-04

AA Sequence

MASAELDYTIEIPDQPCWSQKNSPSPGGKEAETRQPVVILLGWGGCKDKNLAKYSAIYHKRGCIVIRYTA      1 - 70
PWHMVFFSESLGIPSLRVLAQKLLELLFDYEIEKEPLLFHVFSNGGVMLYRYVLELLQTRRFCRLRVVGT     71 - 140
IFDSAPGDSNLVGALRALAAILERRAAMLRLLLLVAFALVVVLFHVLLAPITALFHTHFYDRLQDAGSRW    141 - 210
PELYLYSRADEVVLARDIERMVEARLARRVLARSVDFVSSAHVSHLRDYPTYYTSLCVDFMRNCVRC       211 - 277
//

Text Mined References (10)

PMID Year Title