Property Summary

NCBI Gene PubMed Count 8
PubMed Score 18.31
PubTator Score 0.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 3.7e-06
medulloblastoma, large-cell 6241 1.4e-03
glioblastoma 5792 1.8e-03
astrocytic glioma 2597 1.2e-02
ependymoma 4679 2.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 1.2e-02
ependymoma -1.600 2.5e-02
glioblastoma -1.200 1.8e-03
medulloblastoma, large-cell -1.200 1.4e-03
ovarian cancer -1.200 3.7e-06

Gene RIF (1)

AA Sequence

MNKSQGSVSFTDVTVDFTQEEWEQLDPSQRILYMDVMLENYSNLLSVEVWKADDQMERDHRNPDEQARQF      1 - 70
LILKNQTPIEERGDLFGKALNLNTDFVSLRQVPYKYDLYEKTLKYNSDLLNSNRSYAGKQTDECNEFGKA     71 - 140
LLYLKQEKTHSGVEYSEYNKSGKALSHKAAIFKHQKIKNLVQPFICTYCDKAFSFKSLLISHKRIHTGEK    141 - 210
PYECNVCKKTFSHKANLIKHQRIHTGEKPFECPECGKAFTHQSNLIVHQRAHMEKKPYECSECGKTFAQK    211 - 280
FELTTHQRIHTGERPYECNECAKTFFKKSNLIIHQKIHTGEKRYECSECGKSFIQNSQLIIHMRTHTGEK    281 - 350
PYECTECGKTFSQRSTLRLHLRIHTGEKPYECSECGKAFSRKSRLSVHQRVHIGEKP                 351 - 407
//

Text Mined References (12)

PMID Year Title