Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
R01 Count 4
Funding $691,010.25
PubMed Score 26.71
PubTator Score 4.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.022 0.002
ovarian cancer 1.200 0.000

Synonym

Accession Q6P2C8 O95401 Q4F964 Q5VTA4 Q5VTA5 Q9BU57 Q9NYR4 V9GYV9
Symbols MED3
CRSP8
CRAP34
CRSP34
TRAP37

Gene

Gene RIF (5)

PMID Text
26797421 MED27 promotes melanoma growth by targeting AKT/MAPK and NF-kappaB/iNOS signaling pathways.
25100719 Knockdown of MED27 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
25100719 Knockdown of mediator complex subunit 27 (MED27) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18976975 Knockdown of MED27 by siRNAs inhibits HIV LTR-beta-gal activation in the Tat transactivation assay
18976975 Knockdown of mediator complex subunit 27 (MED27) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MADVINVSVNLEAFSQAISAIQALRSSVSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNEL      1 - 70
ERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGLLNQQSLKRSANQM     71 - 140
GVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMSIHLSRPNGTSAMLLVTLGKVLKVIVVMRSLFID    141 - 210
RTIVKGYNENVYTEDGKLDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLFQAP    211 - 280
CQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ                                           281 - 311
//

Text Mined References (19)

PMID Year Title
26797421 2016 MED27 promotes melanoma growth by targeting AKT/MAPK and NF-?B/iNOS signaling pathways.
24882805 2014 Subunit architecture and functional modular rearrangements of the transcriptional mediator complex.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15989967 2005 MED1/TRAP220 exists predominantly in a TRAP/ Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15175163 2004 A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology.
More...