Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
juvenile dermatomyositis 1189 1.04544680834423E-10
atypical teratoid / rhabdoid tumor 4369 1.77115871577732E-5
glioblastoma 5572 3.78710162946229E-5
ovarian cancer 8492 5.90421183364578E-5
ependymoma 2514 9.15101414215137E-5
psoriasis 6685 1.12575095356569E-4
medulloblastoma, large-cell 6234 2.06672808666443E-4
pediatric high grade glioma 2712 0.00212283673846837
pilocytic astrocytoma 3086 0.00230563781903859
osteosarcoma 7933 0.00822835920544309
acute myeloid leukemia 785 0.00843509783224673
group 3 medulloblastoma 2254 0.0150513190495678
subependymal giant cell astrocytoma 2287 0.0181439296530766

Expression

  Differential Expression (13)

Disease log2 FC p
psoriasis -1.800 0.000
glioblastoma -2.300 0.000
osteosarcoma -1.032 0.008
ependymoma -1.300 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -1.600 0.000
juvenile dermatomyositis 1.098 0.000
pediatric high grade glioma -1.500 0.002
group 3 medulloblastoma -1.100 0.015
pilocytic astrocytoma -1.300 0.002
subependymal giant cell astrocytoma -1.893 0.018
acute myeloid leukemia 1.300 0.008
ovarian cancer -1.600 0.000

Synonym

Accession Q6P280 K7EKE1 Q9H731 Q9HCF7
Symbols

Gene

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Dog OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid

AA Sequence

MANSSFIGDHVHGAPHAVMPEVEFPDQFFTVLTMDHELVTLRDVVINFSQEEWEYLDSAQRNLYWDVMME      1 - 70
NYSNLLSLDLESRNETKHLSVGKDIIQNTGSQWEVMESSKLCGLEGSIFRNDWQSKSKIDLQGPEVGYFS     71 - 140
QMKIISENVPSYKTHESLTLPRRTHDSEKPYEYKEYEKVFSCDLEFDEYQKIHTGGKNYECNQCWKTFGI    141 - 210
DNSSMLQLNIHTGVKPCKYMEYGNTCSFYKDFNVYQKIHNEKFYKCKEYRRTFERVGKVTPLQRVHDGEK    211 - 280
HFECSFCGKSFRVHAQLTRHQKIHTDEKTYKCMECGKDFRFHSQLTEHQRIHTGEKPYKCMHCEKVFRIS    281 - 350
SQLIEHQRIHTGEKPYACKECGKAFGVCRELARHQRIHTGKKPYECKACGKVFRNSSSLTRHQRIHTGEK    351 - 420
PYKCKECEKAFGVGSELTRHERIHSGQKPYECKECGKFFRLTSALIQHQRIHSGEKPYECKVCGKAFRHS    421 - 490
SALTEHQRIHTGEKPYECKACGKAFRHSSSFTKHQRIHTDDKPYECKECGNSFSVVGHLTCQPKIYTGEK    491 - 560
SFD                                                                       561 - 563
//

Text Mined References (8)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10997877 2000 Prediction of the coding sequences of unidentified human genes. XVIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.