Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.297 0.012
tuberculosis 2.300 0.000
group 3 medulloblastoma 1.100 0.008
ovarian cancer 1.900 0.000

Synonym

Accession Q6P1X6 Q6GMR2 Q6P2Q7
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MWPPCGTLRTLALARSRGARACSGDGGVSYTQGQSPEPRTREYFYYVDHQGQLFLDDSKMKNFITCFKDP      1 - 70
QFLVTFFSRLRPNRSGRYEAAFPFLSPCGRERNFLRCEDRPVVFTHLLTADHGPPRLSYCGGGEALAVPF     71 - 140
EPARLLPLAANGRLYHPAPERAGGVGLVRSALAFELSACFEYGPGAPALPSHVRWQGRRLALTMDLAPLL    141 - 210
LAARSP                                                                    211 - 216
//

Text Mined References (3)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.