Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.5e-04
psoriasis 6694 3.4e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Epilepsy 792 0.0 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.239 1.5e-04
psoriasis -1.300 3.4e-04

AA Sequence

MRGGGGCVLALGGQRGFQKERRRMASGNGLPSSSALVAKGPCALGPFPRYIWIHQDTPQDSLDKTCHEIW      1 - 70
KRVQGLPEASQPWTSMEQLSVPVVGTLRGNELSFQEEALELSSGKDEISLLVEQEFLSLTKEHSILVEES     71 - 140
SGELEVPGSSPEGTRELAPCILAPPLVAGSNERPRASIIVGDKLLKQKVAMPVISSRQDCDSATSTVTDI    141 - 210
LCAAEVKSSKGTEDRGRILGDSNLQVSKLLSQFPLKSTETSKVPDNKNVLDKTRVTKDFLQDNLFSGPGP    211 - 280
KEPTGLSPFLLLPPRPPPARPDKLPELPAQKRQLPVFAKICSKPKADPAVERHHLMEWSPGTKEPKKGQG    281 - 350
SLFLSQWPQSQKDACGEEGCCDAVGTASLTLPPKKPTCPAEKNLLYEFLGATKNPSGQPRLRNKVEVDGP    351 - 420
ELKFNAPVTVADKNNPKYTGNVFTPHFPTAMTSATLNQPLWLNLNYPPPPVFTNHSTFLQYQGLYPQQAA    421 - 490
RMPYQQALHPQLGCYSQQVMPYNPQQMGQQIFRSSYTPLLSYIPFVQPNYPYPQRTPPKMSANPRDPPLM    491 - 560
AGDGPQYLFPQGYGFGSTSGGPLMHSPYFSSSGNGINF                                    561 - 598
//

Text Mined References (18)

PMID Year Title