Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.45987457208506E-4
psoriasis 6685 3.35568948459594E-4
Disease Target Count Z-score Confidence
Epilepsy 346 0.0 1.0

AA Sequence

AGDGPQYLFPQGYGFGSTSGGPLMHSPYFSSSGNGINF                                    561 - 598

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25048349 Open reading frames associated with cancer in the dark matter of the human genome.
23088713 2012 Protein interactions of the transcription factor Hoxa1.
22949513 2012 Genome-wide association analysis of genetic generalized epilepsies implicates susceptibility loci at 1q43, 2p16.1, 2q22.3 and 17q21.32.
21516116 2011 Next-generation sequencing to generate interactome datasets.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.