Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.58
PubTator Score 1.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
malignant mesothelioma 3232 1.4e-07
osteosarcoma 7950 2.3e-04

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.600 1.4e-07
osteosarcoma -1.300 2.3e-04

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MAGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAERKVQENSIQRVCQEKQVDY      1 - 70
EINAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKSEVCECRNNEDGPGLIMEEQ     71 - 140
HKCSSKSLEHKTQTPPVEENVTQKISDLEICADEFPGSSATYRILEVGCGVGNTVFPILQTNNDPGLFVY    141 - 210
CCDFSSTAIELVQTNSEYDPSRCFAFVHDLCDEEKSYPVPKGSLDIIILIFVLSAVVPDKMQKAINRLSR    211 - 280
LLKPGGMVLLRDYGRYDMAQLRFKKGQCLSGNFYVRGDGTRVYFFTQEELDTLFTTAGLEKVQNLVDRRL    281 - 350
QVNRGKQLTMYRVWIQCKYCKPLLSSTS                                              351 - 378
//

Text Mined References (17)

PMID Year Title