Property Summary

NCBI Gene PubMed Count 25
PubMed Score 1.43
PubTator Score 12.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma -1.100 0.000
acute quadriplegic myopathy 1.492 0.000
primary pancreatic ductal adenocarcinoma -1.052 0.009
inflammatory breast cancer -1.500 0.000
invasive ductal carcinoma -1.100 0.001
ovarian cancer -1.600 0.000
pancreatic cancer -1.200 0.006

Synonym

Accession Q6P1Q0 A6NER7 B3KXK7 Q6X2E4 Q6X2E5 Q7L2G9 Q7L690 Q8WXW6 Q96PK7 Q9BY59 Q9Y3X3
Symbols HCCR
HCCR1
HCCR2
HCCR-1
HCCR-2
HCRR-2
1110019O13Rik

Gene

Gene RIF (18)

PMID Text
26470691 Demonstrate that HBx-HCCR-E-cadherin regulation pathway might play an important role in HBV-induced hepatocarcinogenesis.
25034723 These findings suggest that HCCR gene is over-expressed in acute leukemia patients and may be a useful biomarker for monitoring minimal residual disease.
24126909 HCCR2 gene plays an important role in the tumorigenesis of leukemia.
22851403 HCCRBP-3 induces tumorigenesis through direct interaction with HCCR-1 in human cancers.
22511601 The data demonstrate that HCCR-1 may be used as a novel predictor for the prognosis of the patients with esophageal squamous cell carcinoma.
21138632 The overexpression of HCCR-2 could enhance the division and proliferation of SMMC 7721 cells.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20591135 induces neoplastic cell transformation and epithelial-mesenchymal transdifferentiation
20423485 Treatment of PANC-1 cells with epidermal growth factor increased HCCR-1 protein level via PI3K/Akt/mTOR signaling.
20196787 HCCR-1 might play a role in the breast tumourigenesis while the overexpression of HCCR-1 induces the obesity probably by inhibiting the cholesterol-lowering effect of ApoE
More...

AA Sequence

MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGK      1 - 70
YHRFLGRHFPRFYVLYTIFMKGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQFRQDVTKCLF     71 - 140
LGIISIPPFANYLVFLLMYLFPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGL    141 - 210
RWRLTDLCTKIQRGTHPAIHDILALRECFSNHPLGMNQLQALHVKALSRAMLLTSYLPPPLLRHRLKTHT    211 - 280
TVIHQLDKALAKLGIGQLTAQEVKSACYLRGLNSTHIGEDRCRTWLGEWLQISCSLKEAELSLLLHNVVL    281 - 350
LSTNYLGTRR                                                                351 - 360
//

Text Mined References (29)

PMID Year Title
26470691 2015 Up-regulation of human cervical cancer proto-oncogene contributes to hepatitis B virus-induced malignant transformation of hepatocyte by down-regulating E-cadherin.
25034723 2015 Quantitative detection of the human cervical cancer oncogene for monitoring the minimal residual disease in acute leukemia.
24126909 2013 Silencing HCCR2 expression inhibits the proliferation of leukemia cells by inducing apoptosis and promoting cell cycle arrest.
22851403 2014 HCCRBP-3 induces tumorigenesis through direct interaction with HCCR-1 in human cancers.
22511601 2012 Clinical implication of elevated human cervical cancer oncogene-1 expression in esophageal squamous cell carcinoma.
21138632 2010 [HCCR-2 enhances the division and proliferation of SMMC 7721 via PI3K/Akt pathway].
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20591135 2010 Transdifferentiation-inducing HCCR-1 oncogene.
20423485 2010 Epidermal growth factor induces HCCR expression via PI3K/Akt/mTOR signaling in PANC-1 pancreatic cancer cells.
20196787 2009 Dual action of apolipoprotein E-interacting HCCR-1 oncoprotein and its implication for breast cancer and obesity.
More...