Property Summary

NCBI Gene PubMed Count 27
PubMed Score 1.43
PubTator Score 12.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Wolf-Hirschhorn syndrome 32 3.779 1.9

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.492 4.5e-08
glioblastoma -1.100 5.5e-06
inflammatory breast cancer -1.500 6.3e-06
invasive ductal carcinoma -1.100 8.9e-04
ovarian cancer -1.600 2.8e-05
pancreatic cancer -1.200 6.0e-03
primary pancreatic ductal adenocarcinoma -1.052 8.7e-03

 GO Function (1)

Gene RIF (19)

AA Sequence

MALSRVCWARSAVWGSAVTPGHFVTRRLQLGRSGLAWGAPRSSKLHLSPKADVKNLMSYVVTKTKAINGK      1 - 70
YHRFLGRHFPRFYVLYTIFMKGLQMLWADAKKARRIKTNMWKHNIKFHQLPYREMEHLRQFRQDVTKCLF     71 - 140
LGIISIPPFANYLVFLLMYLFPRQLLIRHFWTPKQQTDFLDIYHAFRKQSHPEIISYLEKVIPLISDAGL    141 - 210
RWRLTDLCTKIQRGTHPAIHDILALRECFSNHPLGMNQLQALHVKALSRAMLLTSYLPPPLLRHRLKTHT    211 - 280
TVIHQLDKALAKLGIGQLTAQEVKSACYLRGLNSTHIGEDRCRTWLGEWLQISCSLKEAELSLLLHNVVL    281 - 350
LSTNYLGTRR                                                                351 - 360
//

Text Mined References (31)

PMID Year Title