Property Summary

NCBI Gene PubMed Count 40
PubMed Score 46.77
PubTator Score 25.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 1.2e-04
COPD -1.200 5.5e-04
inflammatory breast cancer -1.400 1.4e-04
medulloblastoma, large-cell -1.200 4.7e-05
non primary Sjogren syndrome sicca 1.200 2.1e-02
osteosarcoma 1.903 7.7e-05
ovarian cancer 1.100 5.3e-05
psoriasis 1.400 7.1e-05

Gene RIF (28)

AA Sequence

MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPM      1 - 70
EAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTL     71 - 140
QERLALYQTAIESARQAGDSAKMRRYDRGLKTLENLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPA    141 - 210
PTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDT    211 - 280
TAAARHFRVAKSFDAVLEALSRGEPVDLSCLPPPPDQLPPDPPSPPSQPPTPATAPSTTEVPPPPRTLLE    281 - 350
ALEQRMERYQVAAAQAKSKGDQRKARMHERIVKQYQDAIRAHKAGRAVDVAELPVPPGFPPIQGLEATKP    351 - 420
TQQSLVGVLETAMKLANQDEGPEDEEDEVPKKQNSPVAPTAQPKAPPSRTPQSGSAPTAKAPPKATSTRA    421 - 490
QQQLAFLEGRKKQLLQAALRAKQKNDVEGAKMHLRQAKGLEPMLEASRNGLPVDITKVPPAPVNKDDFAL    491 - 560
VQRPGPGLSQEAARRYGELTKLIRQQHEMCLNHSNQFTQLGNITETTKFEKLAEDCKRSMDILKQAFVRG    561 - 630
LPTPTARFEQRTFSVIKIFPDLSSNDMLLFIVKGINLPTPPGLSPGDLDVFVRFDFPYPNVEEAQKDKTS    631 - 700
VIKNTDSPEFKEQFKLCINRSHRGFRRAIQTKGIKFEVVHKGGLFKTDRVLGTAQLKLDALEIACEVREI    701 - 770
LEVLDGRRPTGGRLEVMVRIREPLTAQQLETTTERWLVIDPVPAAVPTQVAGPKGKAPPVPAPARESGNR    771 - 840
SARPLHSLSVLAFDQERLERKILALRQARRPVPPEVAQQYQDIMQRSQWQRAQLEQGGVGIRREYAAQLE    841 - 910
RQLQFYTEAARRLGNDGSRDAAKEALYRRNLVESELQRLRR                                 911 - 951
//

Text Mined References (47)

PMID Year Title