Property Summary

NCBI Gene PubMed Count 38
Grant Count 24
R01 Count 15
Funding $2,102,514.43
PubMed Score 42.92
PubTator Score 25.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 1.400 0.000
osteosarcoma 1.903 0.000
medulloblastoma, large-cell -1.200 0.000
pilocytic astrocytoma 1.400 0.000
non primary Sjogren syndrome sicca 1.200 0.021
inflammatory breast cancer -1.400 0.000
COPD -1.200 0.001
ovarian cancer 1.100 0.000

Gene RIF (26)

PMID Text
26294214 Aki1 was expressed in human diffuse malignant mesothelioma specimens. Expression correlated with phosphorylated CREB1. Aki1 regulates CREB by modulating protein kinase A activity. The Aki1-CREB axis plays an important role in DMM pathogenesis.
25066123 Null mutations in CC2D1A consistently cause a variable spectrum of presentations including ID, ASD, and seizures. CC2D1A regulates NF-kappaB signaling.
25036909 All of the pancreatic cancer cell lines expressed Aki1. Silencing of Aki1 in Panc1 cells reduced the phosphorylation of Akt and increased the phosphorylation of cleaved PARP.
22944692 Positional proteomics analysis identifies the cleavage of human coiled-coil and C2 domain containing 1A (CC2D1A) at amino acid residues 783-784 by the HIV-1 protease
22833682 TBK1-associated protein in endolysosomes (TAPE)/CC2D1A is a key regulator linking RIG-I-like receptors to antiviral immunity
22406677 CHMP4B interacts directly with CC2D1A and CC2D1B with nanomolar affinity by forming a 1:1 complex.
22328058 Non-genomic downregulation of 5-HT1A receptor by 17betaestradiol does not involve NUDR and Freud-1 proteins.
22258254 CC2D1A interaction with CHMP4B/4A blocks HIV-1 budding.
22023432 Results suggest the involvement of CC2D1A and CC2D2A in mental retardation in the Han Chinese population, and some specific haplotypes may be susceptible or protective.
21274377 Data suggest that the anti-tumor activity of NF-kappaB inhibitors is associated with p53-mediated activation of autophagy.
More...

AA Sequence

MHKRKGPPGPPGRGAAAARQLGLLVDLSPDGLMIPEDGANDEELEAEFLALVGGQPPALEKLKGKGPLPM      1 - 70
EAIEKMASLCMRDPDEDEEEGTDEDDLEADDDLLAELNEVLGEEQKASETPPPVAQPKPEAPHPGLETTL     71 - 140
QERLALYQTAIESARQAGDSAKMRRYDRGLKTLENLLASIRKGNAIDEADIPPPVAIGKGPASTPTYSPA    141 - 210
PTQPAPRIASAPEPRVTLEGPSATAPASSPGLAKPQMPPGPCSPGPLAQLQSRQRDYKLAALHAKQQGDT    211 - 280
TAAARHFRVAKSFDAVLEALSRGEPVDLSCLPPPPDQLPPDPPSPPSQPPTPATAPSTTEVPPPPRTLLE    281 - 350
ALEQRMERYQVAAAQAKSKGDQRKARMHERIVKQYQDAIRAHKAGRAVDVAELPVPPGFPPIQGLEATKP    351 - 420
TQQSLVGVLETAMKLANQDEGPEDEEDEVPKKQNSPVAPTAQPKAPPSRTPQSGSAPTAKAPPKATSTRA    421 - 490
QQQLAFLEGRKKQLLQAALRAKQKNDVEGAKMHLRQAKGLEPMLEASRNGLPVDITKVPPAPVNKDDFAL    491 - 560
VQRPGPGLSQEAARRYGELTKLIRQQHEMCLNHSNQFTQLGNITETTKFEKLAEDCKRSMDILKQAFVRG    561 - 630
LPTPTARFEQRTFSVIKIFPDLSSNDMLLFIVKGINLPTPPGLSPGDLDVFVRFDFPYPNVEEAQKDKTS    631 - 700
VIKNTDSPEFKEQFKLCINRSHRGFRRAIQTKGIKFEVVHKGGLFKTDRVLGTAQLKLDALEIACEVREI    701 - 770
LEVLDGRRPTGGRLEVMVRIREPLTAQQLETTTERWLVIDPVPAAVPTQVAGPKGKAPPVPAPARESGNR    771 - 840
SARPLHSLSVLAFDQERLERKILALRQARRPVPPEVAQQYQDIMQRSQWQRAQLEQGGVGIRREYAAQLE    841 - 910
RQLQFYTEAARRLGNDGSRDAAKEALYRRNLVESELQRLRR                                 911 - 951
//

Text Mined References (45)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26294214 2015 Akt Kinase-Interacting Protein 1 Signals through CREB to Drive Diffuse Malignant Mesothelioma.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25066123 2014 CC2D1A regulates human intellectual and social function as well as NF-?B signaling homeostasis.
25036909 2014 Expression of Akt kinase-interacting protein 1, a scaffold protein of the PI3K/PDK1/Akt pathway, in pancreatic cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22833682 2012 TBK1-associated protein in endolysosomes (TAPE)/CC2D1A is a key regulator linking RIG-I-like receptors to antiviral immunity.
22406677 2012 CC2D1A is a regulator of ESCRT-III CHMP4B.
More...