Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.40
PubTator Score 0.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 7.6e-07
malignant mesothelioma 3232 1.2e-05
Pick disease 1894 1.1e-03
lung cancer 4740 2.2e-02
astrocytic glioma 2597 4.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.200 4.9e-02
lung cancer 1.200 2.2e-02
malignant mesothelioma -1.100 1.2e-05
ovarian cancer -1.200 7.6e-07
Pick disease -1.200 1.1e-03

AA Sequence

MVDSGTEARARGKAEAGLQDGISGPATARVNGKTQAEAVAEAELKTESVTQAKAGDGAMTRTHTVTYREA      1 - 70
MAVTREVIKVEDTTKTRVMVETKTKPLAERSIVPQTKSKAMPMSRVSTVTKSEVKVVAVIEANIRSYAKS     71 - 140
HDKANTGSRPDRREETSIGMKSSDEDEENICSWFWTGEEPSVGSWFWPEEETSLQVYKPLPKIQEKPKPT    141 - 210
HKPTLTIKQKVIAWSRARYIVLVPVEGGEQSLPPEGNWTLVETLIETPLGIRPLTKIPPYHGPYYQTLAE    211 - 280
IKKQIRQREKYGPNPKACHCKSRGFSLEPKEFDKLVALLKLTKDPFIHEIATMIMGISPAYPFTQDIIHD    281 - 350
VGITVMIENLVNNPNVKEHPGALSMVDDSSESSEEPKSGESYIHQVCKGIISCPLNSPVQLAGLKLLGHL    351 - 420
SIKFEDHYVITSYIPDFLTLLNKGSVKTKFYVLKVFSCLSKNHANTRELISAKVLSSLVAPFNKNESKAN    421 - 490
ILNIIEIFENINFQFKTKAKLFTKEKFTKSELISIFQEAKQFGQKLQDLAEHSDPEVRDKVIRLILKL      491 - 558
//

Text Mined References (11)

PMID Year Title