Property Summary

NCBI Gene PubMed Count 29
Grant Count 13
R01 Count 8
Funding $1,845,148.26
PubMed Score 57.32
PubTator Score 34.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
psoriasis 1.200 0.000
ulcerative colitis -1.300 0.000
ovarian cancer -1.300 0.000

Gene RIF (17)

PMID Text
26548558 we resequenced the SLC27A3 and SLC27A4 genes using 267 autism spectrum disorders(ASD) patient and 1140 control samples and detected 47 and 30 variants for the SLC27A3 and SLC27A4, revealing that they are highly polymorphic with multiple rare variants.
24889544 We describe two siblings with ichthyosis prematurity syndrome and report a recurrent homozygous mutation (c.1430T>A) that is predicted to lead to a p.Val477Asp substitution in fatty acid transport protein 4.
24503477 the cell surface protein CD36/FAT directly facilitates fatty acid transport across the plasma membrane, whereas the intracellular acyl-CoA synthetases FATP4 and ACSL1 enhance fatty acid uptake indirectly by metabolic trapping
24120574 the clinical implications of defects in these transporters and relevant animal models, including the FATP4 animal models and ichthyosis prematurity syndrome, a congenital ichthyosis caused by FATP4 deficiency. [review]
23290633 FATP4, ichthyin and TGM1 interact in lipid processing essential for maintaining the epidermal barrier function
23271751 FATP4 plays crucial roles in the development and maturation of both sebaceous and meibomian glands, as well as in the formation and composition of sebum
22235293 FATP1 and FATP4 proteins perform different functional roles in handling long chain fatty acids in skeletal muscle
22190034 HIV-1 Vpu is identified to have a physical interaction with solute carrier family 27 (fatty acid transporter), member 4 (SLC27A4) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22028793 even though hypoxia regulates the expression of FATP2 and FATP4 in human trophoblasts, mouse Fatp2 and Fatp4 are not essential for intrauterine fetal growth.
20965718 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MLLGASLVGVLLFSKLVLKLPWTQVGFSLLFLYLGSGGWRFIRVFIKTIRRDIFGGLVLLKVKAKVRQCL      1 - 70
QERRTVPILFASTVRRHPDKTALIFEGTDTHWTFRQLDEYSSSVANFLQARGLASGDVAAIFMENRNEFV     71 - 140
GLWLGMAKLGVEAALINTNLRRDALLHCLTTSRARALVFGSEMASAICEVHASLDPSLSLFCSGSWEPGA    141 - 210
VPPSTEHLDPLLKDAPKHLPSCPDKGFTDKLFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPND    211 - 280
IVYDCLPLYHSAGNIVGIGQCLLHGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAE    281 - 350
NQHQVRMALGNGLRQSIWTNFSSRFHIPQVAEFYGATECNCSLGNFDSQVGACGFNSRILSFVYPIRLVR    351 - 420
VNEDTMELIRGPDGVCIPCQPGEPGQLVGRIIQKDPLRRFDGYLNQGANNKKIAKDVFKKGDQAYLTGDV    421 - 490
LVMDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLDMADVAVYGVEVPGTEGRAGMAAVASPTGNC    491 - 560
DLERFAQVLEKELPLYARPIFLRLLPELHKTGTYKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQ    561 - 630
EAYSRIQAGEEKL                                                             631 - 643
//

Text Mined References (30)

PMID Year Title
26548558 2015 Investigation of the fatty acid transporter-encoding genes SLC27A3 and SLC27A4 in autism.
24889544 Ichthyosis prematurity syndrome: a case report and review of known mutations.
24503477 2014 Protein mediated fatty acid uptake: synergy between CD36/FAT-facilitated transport and acyl-CoA synthetase-driven metabolism.
24120574 2014 Fatty acid transporters in skin development, function and disease.
23290633 2013 Interactions between FATP4 and ichthyin in epidermal lipid processing may provide clues to the pathogenesis of autosomal recessive congenital ichthyosis.
23271751 2013 Requirement of fatty acid transport protein 4 for development, maturation, and function of sebaceous glands in a mouse model of ichthyosis prematurity syndrome.
22235293 2012 Enhanced fatty acid oxidation and FATP4 protein expression after endurance exercise training in human skeletal muscle.
22028793 2011 The expression and function of fatty acid transport protein-2 and -4 in the murine placenta.
22022213 2011 Overexpression of CD36 and acyl-CoA synthetases FATP2, FATP4 and ACSL1 increases fatty acid uptake in human hepatoma cells.
21269460 2011 Initial characterization of the human central proteome.
More...