Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.00
PubTator Score 1.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.077 0.048
acute myeloid leukemia -1.300 0.027
Breast cancer 1.100 0.000

Synonym

Accession Q6P1L8 B2R575 Q96Q72 L14mt
Symbols L14mt
L32mt
MRPL32
RMPL32
RPML32
MRP-L14
MRP-L32

Gene

PDB

3J9M   3J7Y  

Gene RIF (2)

PMID Text
23171548 C7orf30 promotes incorporation of MRPL14 into the mitochondrial large ribosomal subunit.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAFFTGLWGPFTCVSRVLSHHCFSTTGSLSAIQKMTRVRVVDNSALGNSPYHRAPRCIHVYKKNGVGKVG      1 - 70
DQILLAIKGQKKKALIVGHCMPGPRMTPRFDSNNVVLIEDNGNPVGTRIKTPIPTSLRKREGEYSKVLAI     71 - 140
AQNFV                                                                     141 - 145
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23171548 2013 The conserved interaction of C7orf30 with MRPL14 promotes biogenesis of the mitochondrial large ribosomal subunit and mitochondrial translation.
22829778 2012 RsfA (YbeB) proteins are conserved ribosomal silencing factors.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21757650 2011 Identification of cis- and trans-acting genetic variants explaining up to half the variation in circulating vascular endothelial growth factor levels.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...