Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.00
PubTator Score 1.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3098 1.6e-06
acute myeloid leukemia 785 2.7e-02
osteosarcoma 7933 4.8e-02

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.077 4.8e-02
acute myeloid leukemia -1.300 2.7e-02
Breast cancer 1.100 1.6e-06

Synonym

Accession Q6P1L8 B2R575 Q96Q72 L14mt
Symbols L14mt
L32mt
MRPL32
RMPL32
RPML32
MRP-L14
MRP-L32

Gene

PDB

3J9M   3J7Y  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
23171548 C7orf30 promotes incorporation of MRPL14 into the mitochondrial large ribosomal subunit.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAFFTGLWGPFTCVSRVLSHHCFSTTGSLSAIQKMTRVRVVDNSALGNSPYHRAPRCIHVYKKNGVGKVG      1 - 70
DQILLAIKGQKKKALIVGHCMPGPRMTPRFDSNNVVLIEDNGNPVGTRIKTPIPTSLRKREGEYSKVLAI     71 - 140
AQNFV                                                                     141 - 145
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25278503 2014 Structure of the large ribosomal subunit from human mitochondria.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23171548 2013 The conserved interaction of C7orf30 with MRPL14 promotes biogenesis of the mitochondrial large ribosomal subunit and mitochondrial translation.
22829778 2012 RsfA (YbeB) proteins are conserved ribosomal silencing factors.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21757650 2011 Identification of cis- and trans-acting genetic variants explaining up to half the variation in circulating vascular endothelial growth factor levels.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12706105 2003 Identification and characterization of over 100 mitochondrial ribosomal protein pseudogenes in the human genome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11543634 2001 The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders.
9857009 1998 Mammalian mitochondrial ribosomal proteins. N-terminal amino acid sequencing, characterization, and identification of corresponding gene sequences.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.