Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.11
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
group 4 medulloblastoma 1875 5.14312267649843E-10
non-small cell lung cancer 2798 1.14419459493425E-8
ovarian cancer 8492 1.76050281503127E-8
atypical teratoid / rhabdoid tumor 4369 2.14822399259834E-7
medulloblastoma, large-cell 6234 3.02808735881529E-6
tuberculosis and treatment for 6 months 686 4.02648821371621E-5
cystic fibrosis 1670 1.03723311339677E-4
urothelial carcinoma 318 6.03036371607341E-4
primitive neuroectodermal tumor 3031 0.00181835478854521
glioblastoma 5572 0.00311995131180437
subependymal giant cell astrocytoma 2287 0.00590721088542491
aldosterone-producing adenoma 664 0.0333988561589569
Disease Target Count Z-score Confidence
sarcoidosis 368 3.183 1.6

Expression

Synonym

Accession Q6P1L5 Q53QZ5 Q585T9 Q8N8W1 Q96Q34
Symbols ALS2CR13

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

 GWAS Trait (1)

Pathway (1)

AA Sequence

MSQRVRRNGSPTPAGSLGGGAVATAGGPGSRLQPMRATVPFQLKQQQQQQHGSPTRSGGGGGGNNNGGCC      1 - 70
GGASGPAGGGGGGGPRTASRSTSPTRGGGNAAARTSPTVATQTGASATSTRGTSPTRSAAPGARGSPPRP     71 - 140
PPPPPLLGTVSSPSSSPTHLWTGEVSAAPPPARVRHRRRSPEQSRSSPEKRSPSAPVCKAGDKTRQPSSS    141 - 210
PSSIIRRTSSLDTLAAPYLAGHWPRDSHGQAAPCMRDKATQTESAWAEEYSEKKKGSHKRSASWGSTDQL    211 - 280
KEIAKLRQQLQRSKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLN    281 - 350
QEIEIIIKETGEKEEQLIPQDIPDGHRAPPPLVQRSSSTRSIDTQTPGGADRGSNNSSRSQSVSPTSFLT    351 - 420
ISNEGSEESPCSADDLLVDPRDKENGNNSPLPKYATSPKPNNSYMFKREPPEGCERVKVFEECSPKQLHE    421 - 490
IPAFYCPDKNKVNFIPKSGSAFCLVSILKPLLPTPDLTLKGSGHSLTVTTGMTTTLLQPIAVASLSTNTE    491 - 560
QDRVSRGTSTVMPSASLLPPPEPIEEAEG                                             561 - 589
//

Text Mined References (19)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...