Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.11
PubTator Score 0.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
aldosterone-producing adenoma -1.160 3.3e-02
atypical teratoid / rhabdoid tumor 1.300 2.1e-07
cystic fibrosis 1.564 1.0e-04
glioblastoma -1.300 3.1e-03
group 3 medulloblastoma 1.200 3.6e-04
medulloblastoma, large-cell 2.000 3.0e-06
non-small cell lung cancer 1.065 1.1e-08
ovarian cancer 1.500 1.8e-08
primitive neuroectodermal tumor 1.100 1.8e-03
subependymal giant cell astrocytoma -2.277 5.9e-03
tuberculosis 1.100 4.6e-05
urothelial carcinoma -1.300 6.0e-04

Synonym

Accession Q6P1L5 Q53QZ5 Q585T9 Q8N8W1 Q96Q34
Symbols ALS2CR13

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MSQRVRRNGSPTPAGSLGGGAVATAGGPGSRLQPMRATVPFQLKQQQQQQHGSPTRSGGGGGGNNNGGCC      1 - 70
GGASGPAGGGGGGGPRTASRSTSPTRGGGNAAARTSPTVATQTGASATSTRGTSPTRSAAPGARGSPPRP     71 - 140
PPPPPLLGTVSSPSSSPTHLWTGEVSAAPPPARVRHRRRSPEQSRSSPEKRSPSAPVCKAGDKTRQPSSS    141 - 210
PSSIIRRTSSLDTLAAPYLAGHWPRDSHGQAAPCMRDKATQTESAWAEEYSEKKKGSHKRSASWGSTDQL    211 - 280
KEIAKLRQQLQRSKHSSRHHRDKERQSPFHGNHAAINQCQAPVPKSALIPVIPITKSTGSRFRNSVEGLN    281 - 350
QEIEIIIKETGEKEEQLIPQDIPDGHRAPPPLVQRSSSTRSIDTQTPGGADRGSNNSSRSQSVSPTSFLT    351 - 420
ISNEGSEESPCSADDLLVDPRDKENGNNSPLPKYATSPKPNNSYMFKREPPEGCERVKVFEECSPKQLHE    421 - 490
IPAFYCPDKNKVNFIPKSGSAFCLVSILKPLLPTPDLTLKGSGHSLTVTTGMTTTLLQPIAVASLSTNTE    491 - 560
QDRVSRGTSTVMPSASLLPPPEPIEEAEG                                             561 - 589
//

Text Mined References (19)

PMID Year Title