Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.25
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.843 6.5e-06
Alzheimer's disease 1.100 2.3e-02
astrocytic glioma 2.100 4.2e-03
ependymoma 3.000 8.7e-03
Gaucher disease type 1 -2.200 4.6e-02
glioblastoma -1.500 3.2e-03
lung cancer 2.400 1.2e-05
malignant mesothelioma 1.400 3.8e-06
medulloblastoma, large-cell -1.600 1.7e-02
oligodendroglioma 2.400 9.4e-04
ovarian cancer -1.500 7.9e-09
Pick disease 1.300 8.6e-05
psoriasis -2.100 1.9e-03

AA Sequence

MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRT      1 - 70
MEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKEAVDMTCH     71 - 140
GEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTV    141 - 210
LARETGGTYHVILDESHYKELLTHHLSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNT    211 - 280
EPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQG    281 - 350
ELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV                             351 - 395
//

Text Mined References (8)

PMID Year Title