Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.25
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
astrocytic glioma 2.100 0.004
ependymoma 3.000 0.009
oligodendroglioma 2.400 0.001
psoriasis -2.100 0.002
glioblastoma -1.500 0.003
medulloblastoma, large-cell -1.600 0.017
adrenocortical carcinoma 1.843 0.000
lung cancer 2.400 0.000
Alzheimer's disease 1.100 0.023
Pick disease 1.300 0.000
ovarian cancer -1.500 0.000
Gaucher disease type 1 -2.200 0.046

Synonym

Accession Q6P1K8 A6NED9 A8K8J6 B2RCU4 B7ZW39
Symbols GTF2H2D

Gene

 GO Function (1)

 GO Component (1)

AA Sequence

MDEEPERTKRWEGGYERTWEILKEDESGSLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRT      1 - 70
MEDQDLKPNRLTCTLKLLEYFVEEYFDQNPISQIGIIVTKSKRAEKLTELSGNPRKHITSLKEAVDMTCH     71 - 140
GEPSLYNSLSMAMQTLKHMPGHTSREVLIIFSSLTTCDPSNIYDLIKTLKAAKIRVSVIGLSAEVRVCTV    141 - 210
LARETGGTYHVILDESHYKELLTHHLSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNT    211 - 280
EPGLTLGGYFCPQCRAKYCELPVECKICGLTLVSAPHLARSYHHLFPLDAFQEIPLEEYNGERFCYGCQG    281 - 350
ELKDQHVYVCAVCQNVFCVDCDVFVHDSLHCCPGCIHKIPAPSGV                             351 - 395
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
15496913 2004 Finishing the euchromatic sequence of the human genome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11237011 2001 Initial sequencing and analysis of the human genome.