Property Summary

NCBI Gene PubMed Count 18
PubMed Score 4.93
PubTator Score 15.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma 1.300 5.5e-04
medulloblastoma, large-cell 1.100 8.5e-06
ovarian cancer 1.100 3.9e-05
Rheumatoid arthritis -1.200 2.8e-03

Gene RIF (4)

AA Sequence

MAEASSANLGSGCEEKRHEGSSSESVPPGTTISRVKLLDTMVDTFLQKLVAAGSYQRFTDCYKCFYQLQP      1 - 70
AMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNALDKIVEEGKVRKEPAWRPSGIPEKDLHSVMAPY     71 - 140
FLQQRDTLRRHVQKQEAENQQLADAVLAGRRQVEELQLQVQAQQQAWQALHREQRELVAVLREPE         141 - 205
//

Text Mined References (19)

PMID Year Title