Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.61
PubTator Score 8.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.200 0.022
cutaneous lupus erythematosus -1.200 0.001
psoriasis -2.400 0.000
osteosarcoma -3.033 0.000
sonic hedgehog group medulloblastoma -1.900 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.200 0.000
atypical teratoid/rhabdoid tumor -1.200 0.000
lung adenocarcinoma -1.200 0.000
ovarian cancer -1.100 0.001

Synonym

Accession Q6P1K1 Q9BUB3 Q9NX17
Symbols HRG1
HRG-1
hHRG-1

Gene

Gene RIF (8)

PMID Text
24141772 HRG-1 may represent a novel target for selectively disrupting V-ATPase activity and the metastatic potential of cancer cells.
23395172 These results reveal HRG1 as the long-sought heme transporter for heme-iron recycling in macrophages and suggest that genetic variations in HRG1 could be modifiers of human iron metabolism.
22174408 a model in which heme is translocated across membranes facilitated by conserved amino acids positioned on the exoplasmic, cytoplasmic, and transmembrane regions of HRG-1-related proteins.
21555518 SLC48A1 is a target gene of the BACH1 transcription factor according to ChIP-seq analysis in HEK 293 cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19875448 HRG-1 regulates V-ATPase activity, which is essential for endosomal acidification, heme binding, and receptor trafficking in mammalian cells.
18418376 Human and worm proteins localize together, and bind and transport haem, thus establishing an evolutionarily conserved function for HRG-1.

AA Sequence

MAPSRLQLGLRAAYSGISSVAGFSIFLVWTVVYRQPGTAAMGGLAGVLALWVLVTHVMYMQDYWRTWLKG      1 - 70
LRGFFFVGVLFSAVSIAAFCTFLVLAITRHQSLTDPTSYYLSSVWSFISFKWAFLLSLYAHRYRADFADI     71 - 140
SILSDF                                                                    141 - 146
//

Text Mined References (13)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24141772 2014 HRG-1 enhances cancer cell invasive potential and couples glucose metabolism to cytosolic/extracellular pH gradient regulation by the vacuolar-H(+) ATPase.
23395172 2013 HRG1 is essential for heme transport from the phagolysosome of macrophages during erythrophagocytosis.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22174408 2012 Topologically conserved residues direct heme transport in HRG-1-related proteins.
21555518 2011 The BTB and CNC homology 1 (BACH1) target genes are involved in the oxidative stress response and in control of the cell cycle.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19875448 2010 Heme-binding protein HRG-1 is induced by insulin-like growth factor I and associates with the vacuolar H+-ATPase to control endosomal pH and receptor trafficking.
18418376 2008 Haem homeostasis is regulated by the conserved and concerted functions of HRG-1 proteins.
More...