Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.61
PubTator Score 8.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.200 2.2e-02
atypical teratoid/rhabdoid tumor -1.100 6.8e-07
cutaneous lupus erythematosus -1.200 1.1e-03
group 3 medulloblastoma -1.800 5.4e-05
lung adenocarcinoma -1.200 7.4e-08
medulloblastoma, large-cell -1.900 3.4e-05
osteosarcoma -1.936 9.6e-07
ovarian cancer -1.100 7.2e-04
primitive neuroectodermal tumor -1.100 3.9e-04
psoriasis -1.500 1.4e-04

 GO Process (1)

Gene RIF (8)

AA Sequence

MAPSRLQLGLRAAYSGISSVAGFSIFLVWTVVYRQPGTAAMGGLAGVLALWVLVTHVMYMQDYWRTWLKG      1 - 70
LRGFFFVGVLFSAVSIAAFCTFLVLAITRHQSLTDPTSYYLSSVWSFISFKWAFLLSLYAHRYRADFADI     71 - 140
SILSDF                                                                    141 - 146
//

Text Mined References (13)

PMID Year Title