Property Summary

NCBI Gene PubMed Count 23
Grant Count 12
R01 Count 6
Funding $2,835,962.36
PubMed Score 153.56
PubTator Score 76.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.156 0.001
pancreatic ductal adenocarcinoma liver m... -1.208 0.009
ulcerative colitis -1.300 0.000

Gene RIF (9)

PMID Text
25994902 Our findings suggest that LPCAT3 plays an important role in M1/M2-macrophage polarization, providing novel potential therapeutic targets for the regulation of immune and inflammatory disorders
23580142 LPCAT3 a key contributor to the human macrophages inflammatory response.
20837115 Results establish for the first time that LPCAT3 is specifically regulated by LXRalpha.
20018618 lysoPC acyltransferase 3 is a novel-signal-regulated enzyme that is centrally implicated in limiting free arachidonic acid levels in activated cells
19351971 characterization of LPCAT3; LPCAT3 expression in tissue culture increased phospholipids with relatively more saturated acyl chains; limiting LPCAT3 expression increased abundance of phospholipids with more unsaturated acyl chains
18782225 These results indicate that human MBOAT5 is a lysophospholipid acyltransferase acting preferentially on lysophosphatidylcholine, lysophosphatidylserine and lysophosphatidylethanolamine.
18781350 LPCAT3 is involved in phospholipids remodeling to achieve appropriate membrane lipid fatty acid composition.
18772128 MBOAT5 and MBOAT7 in arachidonate recycling, thus regulating free arachidonic acid levels and leukotriene synthesis in neutrophils
18195019 LPCAT3 is primarily responsible for hepatic LPCAT activity

AA Sequence

MASSAEGDEGTVVALAGVLQSGFQELSLNKLATSLGASEQALRLIISIFLGYPFALFYRHYLFYKETYLI      1 - 70
HLFHTFTGLSIAYFNFGNQLYHSLLCIVLQFLILRLMGRTITAVLTTFCFQMAYLLAGYYYTATGNYDIK     71 - 140
WTMPHCVLTLKLIGLAVDYFDGGKDQNSLSSEQQKYAIRGVPSLLEVAGFSYFYGAFLVGPQFSMNHYMK    141 - 210
LVQGELIDIPGKIPNSIIPALKRLSLGLFYLVGYTLLSPHITEDYLLTEDYDNHPFWFRCMYMLIWGKFV    211 - 280
LYKYVTCWLVTEGVCILTGLGFNGFEEKGKAKWDACANMKVWLFETNPRFTGTIASFNINTNAWVARYIF    281 - 350
KRLKFLGNKELSQGLSLLFLALWHGLHSGYLVCFQMEFLIVIVERQAARLIQESPTLSKLAAITVLQPFY    351 - 420
YLVQQTIHWLFMGYSMTAFCLFTWDKWLKVYKSIYFLGHIFFLSLLFILPYIHKAMVPRKEKLKKME       421 - 487
//

Text Mined References (25)

PMID Year Title
25994902 2015 Essential Role of Lysophosphatidylcholine Acyltransferase 3 in the Induction of Macrophage Polarization in PMA-Treated U937 Cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23580142 2013 Liver x receptor regulates arachidonic acid distribution and eicosanoid release in human macrophages: a key role for lysophosphatidylcholine acyltransferase 3.
22511767 2012 Lysophosphatidylcholine acyltransferase 3 knockdown-mediated liver lysophosphatidylcholine accumulation promotes very low density lipoprotein production by enhancing microsomal triglyceride transfer protein expression.
20837115 2011 Regulation of LPCAT3 by LXR.
20018618 2010 Signaling role for lysophosphatidylcholine acyltransferase 3 in receptor-regulated arachidonic acid reacylation reactions in human monocytes.
19946888 2010 Defining the membrane proteome of NK cells.
19351971 2009 Characterization of human lysophospholipid acyltransferase 3.
18782225 2008 Member of the membrane-bound O-acyltransferase (MBOAT) family encodes a lysophospholipid acyltransferase with broad substrate specificity.
18781350 2008 Substrate preferences of a lysophosphatidylcholine acyltransferase highlight its role in phospholipid remodeling.
More...