Property Summary

NCBI Gene PubMed Count 25
PubMed Score 162.80
PubTator Score 76.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Glomerulonephritis 46 3.421 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.156 9.9e-04
pancreatic ductal adenocarcinoma liver m... -1.208 9.5e-03
ulcerative colitis -1.300 1.1e-07

Gene RIF (11)

AA Sequence

MASSAEGDEGTVVALAGVLQSGFQELSLNKLATSLGASEQALRLIISIFLGYPFALFYRHYLFYKETYLI      1 - 70
HLFHTFTGLSIAYFNFGNQLYHSLLCIVLQFLILRLMGRTITAVLTTFCFQMAYLLAGYYYTATGNYDIK     71 - 140
WTMPHCVLTLKLIGLAVDYFDGGKDQNSLSSEQQKYAIRGVPSLLEVAGFSYFYGAFLVGPQFSMNHYMK    141 - 210
LVQGELIDIPGKIPNSIIPALKRLSLGLFYLVGYTLLSPHITEDYLLTEDYDNHPFWFRCMYMLIWGKFV    211 - 280
LYKYVTCWLVTEGVCILTGLGFNGFEEKGKAKWDACANMKVWLFETNPRFTGTIASFNINTNAWVARYIF    281 - 350
KRLKFLGNKELSQGLSLLFLALWHGLHSGYLVCFQMEFLIVIVERQAARLIQESPTLSKLAAITVLQPFY    351 - 420
YLVQQTIHWLFMGYSMTAFCLFTWDKWLKVYKSIYFLGHIFFLSLLFILPYIHKAMVPRKEKLKKME       421 - 487
//

Text Mined References (27)

PMID Year Title