Property Summary

NCBI Gene PubMed Count 44
Grant Count 16
R01 Count 7
Funding $1,612,716.57
PubMed Score 46.00
PubTator Score 51.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
743319 confirmatory 61 / 1 / 89 MLPCN ERAP2 Measured in Biochemical System Using Plate Reader - 7016-02_Inhibitor_Dose_CherryPick_Activity
743320 confirmatory 2 / 0 / 149 MLPCN ERAP2 Measured in Biochemical System Using Plate Reader - 7016-02_Inhibitor_Dose_CherryPick_Activity_Set2

Gene RIF (35)

PMID Text
27384923 Increased expression of ERAP2 in GC-responders before therapy warrants further investigation into their role as potential predictors for the response to GC, and in the inflammatory process of rheumatoid arthritis.
26148615 ERAP2 might be associated with CLNM in PTMC.
26088389 ERAP2 variation does not have a significant effect on PBMC intracellular and cell surface HLA-class I expression and heavy chain formation, markers of ER stress or inflammatory cytokine production.
25917849 ERAP2 is associated with ankylosing spondylitis in HLA-B27 positive and HLA-B27 negative patients.
25142031 Studies indicate the critical role of M1 aminopeptidases ERAP1, ERAP2 and NPEPPS in immune-mediated diseases.
24957906 The risk allele of the polymorphism near ERAP2 is strongly associated with birdshot chorioretinopathy.
24928998 Data indicate that dimerization of endoplasmic reticulum aminopeptidases ERAP1/2 creates complexes with superior peptide-trimming efficacy.
24223975 concerted aminoproteolytic activity of ERAP 1 and ERAP2
23988446 The association and co-localization of ERAP2 and EpCAM at the surface of breast cancer cells is a unique and novel finding that provides new ideas on EpCAM processing and on how antigen presentation may be regulated in cancer.
23696916 ERAP1 and ERAP2 might be involved in the development of immune escape mechanisms of renal cell carcinoma.
More...

AA Sequence

MFHSSAMVNSHRKPMFNIHRGFYCLTAILPQICICSQFSVPSSYHFTEDPGAFPVATNGERFPWQELRLP      1 - 70
SVVIPLHYDLFVHPNLTSLDFVASEKIEVLVSNATQFIILHSKDLEITNATLQSEEDSRYMKPGKELKVL     71 - 140
SYPAHEQIALLVPEKLTPHLKYYVAMDFQAKLGDGFEGFYKSTYRTLGGETRILAVTDFEPTQARMAFPC    141 - 210
FDEPLFKANFSIKIRRESRHIALSNMPKVKTIELEGGLLEDHFETTVKMSTYLVAYIVCDFHSLSGFTSS    211 - 280
GVKVSIYASPDKRNQTHYALQASLKLLDFYEKYFDIYYPLSKLDLIAIPDFAPGAMENWGLITYRETSLL    281 - 350
FDPKTSSASDKLWVTRVIAHELAHQWFGNLVTMEWWNDIWLKEGFAKYMELIAVNATYPELQFDDYFLNV    351 - 420
CFEVITKDSLNSSRPISKPAETPTQIQEMFDEVSYNKGACILNMLKDFLGEEKFQKGIIQYLKKFSYRNA    421 - 490
KNDDLWSSLSNSCLESDFTSGGVCHSDPKMTSNMLAFLGENAEVKEMMTTWTLQKGIPLLVVKQDGCSLR    491 - 560
LQQERFLQGVFQEDPEWRALQERYLWHIPLTYSTSSSNVIHRHILKSKTDTLDLPEKTSWVKFNVDSNGY    561 - 630
YIVHYEGHGWDQLITQLNQNHTLLRPKDRVGLIHDVFQLVGAGRLTLDKALDMTYYLQHETSSPALLEGL    631 - 700
SYLESFYHMMDRRNISDISENLKRYLLQYFKPVIDRQSWSDKGSVWDRMLRSALLKLACDLNHAPCIQKA    701 - 770
AELFSQWMESSGKLNIPTDVLKIVYSVGAQTTAGWNYLLEQYELSMSSAEQNKILYALSTSKHQEKLLKL    771 - 840
IELGMEGKVIKTQNLAALLHAIARRPKGQQLAWDFVRENWTHLLKKFDLGSYDIRMIISGTTAHFSSKDK    841 - 910
LQEVKLFFESLEAQGSHLDIFQTVLETITKNIKWLEKNLPTLRTWLMVNT                        911 - 960
//

Text Mined References (49)

PMID Year Title
27384923 Expression of ERAP2 and LST1 is increased before start of therapy in rheumatoid arthritis patients with good clinical response to glucocorticoids.
26148615 Endoplasmic reticulum aminopeptidase 2 is highly expressed in papillary thyroid microcarcinoma with cervical lymph node metastasis.
26088389 2015 ERAP2 functional knockout in humans does not alter surface heavy chains or HLA-B27, inflammatory cytokines or endoplasmic reticulum stress markers.
25917849 2015 ERAP2 is associated with ankylosing spondylitis in HLA-B27-positive and HLA-B27-negative patients.
25142031 2014 Genetic associations and functional characterization of M1 aminopeptidases and immune-mediated diseases.
24957906 2014 A genome-wide association study identifies a functional ERAP2 haplotype associated with birdshot chorioretinopathy.
24928998 2014 ERAP1-ERAP2 dimerization increases peptide-trimming efficiency.
24223975 2013 Concerted in vitro trimming of viral HLA-B27-restricted ligands by human ERAP1 and ERAP2 aminopeptidases.
23988446 2013 EpCAM associates with endoplasmic reticulum aminopeptidase 2 (ERAP2) in breast cancer cells.
23696916 2013 Comparative expression profiling for human endoplasmic reticulum-resident aminopeptidases 1 and 2 in normal kidney versus distinct renal cell carcinoma subtypes.
More...