Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.300 4.3e-02
osteosarcoma -1.302 3.8e-04
ovarian cancer -1.600 6.5e-08
pancreatic ductal adenocarcinoma liver m... -1.775 1.1e-02

Synonym

Accession Q6P161 L54mt
Symbols L54mt
MRP-L54

Gene

PDB

3J9M   5OOL   5OOM  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (2)

AA Sequence

MATKRLFGATRTWAGWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKGAVTSEALKDPDVCTDPVQLTT      1 - 70
YAMGVNIYKEGQDVPLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWRRLRKQNIWRHNRLSKNKRL       71 - 138
//

Text Mined References (13)

PMID Year Title