Property Summary

NCBI Gene PubMed Count 29
Grant Count 8
Funding $5,787,680.33
PubMed Score 18.64
PubTator Score 20.02

Knowledge Summary

Patent (4,171)

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.200 0.001
osteosarcoma 1.950 0.000
ependymoma -1.100 0.000
group 4 medulloblastoma 1.700 0.000
intraductal papillary-mucinous carcinoma... 1.100 0.003
intraductal papillary-mucinous neoplasm ... 1.100 0.002
gastric carcinoma 1.400 0.010
ulcerative colitis -1.200 0.000

Gene RIF (8)

PMID Text
26203179 we observed 3 case-specific duplications of the autosomal gene MAST2, and in a replication phase we found another 11 duplications
25942057 Viral and PTEN peptide interactions to MAST2-PDZ occur via a unique kinetic step which involves both canonical C-terminal PBM binding and N-terminal anchoring.
24140425 MAST2 gene rearrangements occur in invasive breast carcinoma.
23504457 MAST205 plays an important role in regulating CFTR expression and function
22609064 The MAST2 sequence at the 5' end of SVA(F1) acts as a positive transcriptional regulator in human germ cells.
22101766 Overexpression of MAST1 or MAST2 gene fusions has a proliferative effect both in vitro and in vivo in breast cancer cell lines.
19961423 Recruitment of a MAST2 CpG island was most likely beneficial to the hybrid retrotransposons because it could significantly increase retrotransposition frequency.
19635844 Studies report the identification of a new subfamily of SVA, which apparently formed after an alternative splicing event where the first exon of the MAST2 gene spliced into an intronic SVA and subsequently retrotransposed.

AA Sequence

MKRSRCRDRPQPPPPDRREDGVQRAAELSQSLPPRRRAPPGRQRLEERTGPAGPEGKEQDVVTGVSPLLF      1 - 70
RKLSNPDIFSSTGKVKLQRQLSQDDCKLWRGNLASSLSGKQLLPLSSSVHSSVGQVTWQSSGEASNLVRM     71 - 140
RNQSLGQSAPSLTAGLKELSLPRRGSFCRTSNRKSLIVTSSTSPTLPRPHSPLHGHTGNSPLDSPRNFSP    141 - 210
NAPAHFSFVPARRTDGRRWSLASLPSSGYGTNTPSSTVSSSCSSQEKLHQLPFQPTADELHFLTKHFSTE    211 - 280
SVPDEEGRQSPAMRPRSRSLSPGRSPVSFDSEIIMMNHVYKERFPKATAQMEERLAEFISSNTPDSVLPL    281 - 350
ADGALSFIHHQVIEMARDCLDKSRSGLITSQYFYELQDNLEKLLQDAHERSESSEVAFVMQLVKKLMIII    351 - 420
ARPARLLECLEFDPEEFYHLLEAAEGHAKEGQGIKCDIPRYIVSQLGLTRDPLEEMAQLSSCDSPDTPET    421 - 490
DDSIEGHGASLPSKKTPSEEDFETIKLISNGAYGAVFLVRHKSTRQRFAMKKINKQNLILRNQIQQAFVE    491 - 560
RDILTFAENPFVVSMFCSFDTKRHLCMVMEYVEGGDCATLLKNIGALPVDMVRLYFAETVLALEYLHNYG    561 - 630
IVHRDLKPDNLLITSMGHIKLTDFGLSKIGLMSLTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQ    631 - 700
GYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQVISDEIVWPEGDEALPPDAQDLTSKLLHQNPLER    701 - 770
LGTGSAYEVKQHPFFTGLDWTGLLRQKAEFIPQLESEDDTSYFDTRSERYHHMDSEDEEEVSEDGCLEIR    771 - 840
QFSSCSPRFNKVYSSMERLSLLEERRTPPPTKRSLSEEKEDHSDGLAGLKGRDRSWVIGSPEILRKRLSV    841 - 910
SESSHTESDSSPPMTVRRRCSGLLDAPRFPEGPEEASSTLRRQPQEGIWVLTPPSGEGVSGPVTEHSGEQ    911 - 980
RPKLDEEAVGRSSGSSPAMETRGRGTSQLAEGATAKAISDLAVRRARHRLLSGDSTEKRTARPVNKVIKS    981 - 1050
ASATALSLLIPSEHHTCSPLASPMSPHSQSSNPSSRDSSPSRDFLPALGSMRPPIIIHRAGKKYGFTLRA   1051 - 1120
IRVYMGDSDVYTVHHMVWHVEDGGPASEAGLRQGDLITHVNGEPVHGLVHTEVVELILKSGNKVAISTTP   1121 - 1190
LENTSIKVGPARKGSYKAKMARRSKRSRGKDGQESRKRSSLFRKITKQASLLHTSRSLSSLNRSLSSGES   1191 - 1260
GPGSPTHSHSLSPRSPTQGYRVTPDAVHSVGGNSSQSSSPSSSVPSSPAGSGHTRPSSLHGLAPKLQRQY   1261 - 1330
RSPRRKSAGSIPLSPLAHTPSPPPPTASPQRSPSPLSGHVAQAFPTKLHLSPPLGRQLSRPKSAEPPRSP   1331 - 1400
LLKRVQSAEKLAAALAASEKKLATSRKHSLDLPHSELKKELPPREVSPLEVVGARSVLSGKGALPGKGVL   1401 - 1470
QPAPSRALGTLRQDRAERRESLQKQEAIREVDSSEDDTEEGPENSQGAQELSLAPHPEVSQSVAPKGAGE   1471 - 1540
SGEEDPFPSRDPRSLGPMVPSLLTGITLGPPRMESPSGPHRRLGSPQAIEEAASSSSAGPNLGQSGATDP   1541 - 1610
IPPEGCWKAQHLHTQALTALSPSTSGLTPTSSCSPPSSTSGKLSMWSWKSLIEGPDRASPSRKATMAGGL   1611 - 1680
ANLQDLENTTPAQPKNLSPREQGKTQPPSAPRLAHPSYEDPSQGWLWESECAQAVKEDPALSITQVPDAS   1681 - 1750
GDRRQDVPCRGCPLTQKSEPSLRRGQEPGGHQKHRDLALVPDELLKQT                         1751 - 1798
//

Text Mined References (39)

PMID Year Title
26203179 2015 A Screen for Genomic Disorders of Infertility Identifies MAST2 Duplications Associated with Nonobstructive Azoospermia in Humans.
25942057 2015 Deciphering the unconventional peptide binding to the PDZ domain of MAST2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24140425 2013 MAST2 and NOTCH1 translocations in breast carcinoma and associated pre-invasive lesions.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23504457 2013 MAST205 competes with cystic fibrosis transmembrane conductance regulator (CFTR)-associated ligand for binding to CFTR to regulate CFTR-mediated fluid transport.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22609064 2012 Transcriptional regulation of human-specific SVAF? retrotransposons by cis-regulatory MAST2 sequences.
22101766 2011 Functionally recurrent rearrangements of the MAST kinase and Notch gene families in breast cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...