Property Summary

NCBI Gene PubMed Count 29
PubMed Score 18.64
PubTator Score 20.02

Knowledge Summary

Patent (4,171)

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.200 8.0e-04
osteosarcoma 1.950 3.6e-06
ependymoma -1.100 8.8e-06
group 4 medulloblastoma 1.700 4.2e-04
intraductal papillary-mucinous carcinoma... 1.100 2.9e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.2e-03
gastric carcinoma 1.400 1.0e-02
ulcerative colitis -1.200 2.5e-07

 GWAS Trait (1)

Pathway (1)

Gene RIF (8)

PMID Text
26203179 we observed 3 case-specific duplications of the autosomal gene MAST2, and in a replication phase we found another 11 duplications
25942057 Viral and PTEN peptide interactions to MAST2-PDZ occur via a unique kinetic step which involves both canonical C-terminal PBM binding and N-terminal anchoring.
24140425 MAST2 gene rearrangements occur in invasive breast carcinoma.
23504457 MAST205 plays an important role in regulating CFTR expression and function
22609064 The MAST2 sequence at the 5' end of SVA(F1) acts as a positive transcriptional regulator in human germ cells.
22101766 Overexpression of MAST1 or MAST2 gene fusions has a proliferative effect both in vitro and in vivo in breast cancer cell lines.
19961423 Recruitment of a MAST2 CpG island was most likely beneficial to the hybrid retrotransposons because it could significantly increase retrotransposition frequency.
19635844 Studies report the identification of a new subfamily of SVA, which apparently formed after an alternative splicing event where the first exon of the MAST2 gene spliced into an intronic SVA and subsequently retrotransposed.

AA Sequence

MKRSRCRDRPQPPPPDRREDGVQRAAELSQSLPPRRRAPPGRQRLEERTGPAGPEGKEQDVVTGVSPLLF      1 - 70
RKLSNPDIFSSTGKVKLQRQLSQDDCKLWRGNLASSLSGKQLLPLSSSVHSSVGQVTWQSSGEASNLVRM     71 - 140
RNQSLGQSAPSLTAGLKELSLPRRGSFCRTSNRKSLIVTSSTSPTLPRPHSPLHGHTGNSPLDSPRNFSP    141 - 210
NAPAHFSFVPARRTDGRRWSLASLPSSGYGTNTPSSTVSSSCSSQEKLHQLPFQPTADELHFLTKHFSTE    211 - 280
SVPDEEGRQSPAMRPRSRSLSPGRSPVSFDSEIIMMNHVYKERFPKATAQMEERLAEFISSNTPDSVLPL    281 - 350
ADGALSFIHHQVIEMARDCLDKSRSGLITSQYFYELQDNLEKLLQDAHERSESSEVAFVMQLVKKLMIII    351 - 420
ARPARLLECLEFDPEEFYHLLEAAEGHAKEGQGIKCDIPRYIVSQLGLTRDPLEEMAQLSSCDSPDTPET    421 - 490
DDSIEGHGASLPSKKTPSEEDFETIKLISNGAYGAVFLVRHKSTRQRFAMKKINKQNLILRNQIQQAFVE    491 - 560
RDILTFAENPFVVSMFCSFDTKRHLCMVMEYVEGGDCATLLKNIGALPVDMVRLYFAETVLALEYLHNYG    561 - 630
IVHRDLKPDNLLITSMGHIKLTDFGLSKIGLMSLTTNLYEGHIEKDAREFLDKQVCGTPEYIAPEVILRQ    631 - 700
GYGKPVDWWAMGIILYEFLVGCVPFFGDTPEELFGQVISDEIVWPEGDEALPPDAQDLTSKLLHQNPLER    701 - 770
LGTGSAYEVKQHPFFTGLDWTGLLRQKAEFIPQLESEDDTSYFDTRSERYHHMDSEDEEEVSEDGCLEIR    771 - 840
QFSSCSPRFNKVYSSMERLSLLEERRTPPPTKRSLSEEKEDHSDGLAGLKGRDRSWVIGSPEILRKRLSV    841 - 910
SESSHTESDSSPPMTVRRRCSGLLDAPRFPEGPEEASSTLRRQPQEGIWVLTPPSGEGVSGPVTEHSGEQ    911 - 980
RPKLDEEAVGRSSGSSPAMETRGRGTSQLAEGATAKAISDLAVRRARHRLLSGDSTEKRTARPVNKVIKS    981 - 1050
ASATALSLLIPSEHHTCSPLASPMSPHSQSSNPSSRDSSPSRDFLPALGSMRPPIIIHRAGKKYGFTLRA   1051 - 1120
IRVYMGDSDVYTVHHMVWHVEDGGPASEAGLRQGDLITHVNGEPVHGLVHTEVVELILKSGNKVAISTTP   1121 - 1190
LENTSIKVGPARKGSYKAKMARRSKRSRGKDGQESRKRSSLFRKITKQASLLHTSRSLSSLNRSLSSGES   1191 - 1260
GPGSPTHSHSLSPRSPTQGYRVTPDAVHSVGGNSSQSSSPSSSVPSSPAGSGHTRPSSLHGLAPKLQRQY   1261 - 1330
RSPRRKSAGSIPLSPLAHTPSPPPPTASPQRSPSPLSGHVAQAFPTKLHLSPPLGRQLSRPKSAEPPRSP   1331 - 1400
LLKRVQSAEKLAAALAASEKKLATSRKHSLDLPHSELKKELPPREVSPLEVVGARSVLSGKGALPGKGVL   1401 - 1470
QPAPSRALGTLRQDRAERRESLQKQEAIREVDSSEDDTEEGPENSQGAQELSLAPHPEVSQSVAPKGAGE   1471 - 1540
SGEEDPFPSRDPRSLGPMVPSLLTGITLGPPRMESPSGPHRRLGSPQAIEEAASSSSAGPNLGQSGATDP   1541 - 1610
IPPEGCWKAQHLHTQALTALSPSTSGLTPTSSCSPPSSTSGKLSMWSWKSLIEGPDRASPSRKATMAGGL   1611 - 1680
ANLQDLENTTPAQPKNLSPREQGKTQPPSAPRLAHPSYEDPSQGWLWESECAQAVKEDPALSITQVPDAS   1681 - 1750
GDRRQDVPCRGCPLTQKSEPSLRRGQEPGGHQKHRDLALVPDELLKQT                         1751 - 1798
//

Text Mined References (39)

PMID Year Title
26203179 2015 A Screen for Genomic Disorders of Infertility Identifies MAST2 Duplications Associated with Nonobstructive Azoospermia in Humans.
25942057 2015 Deciphering the unconventional peptide binding to the PDZ domain of MAST2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24140425 2013 MAST2 and NOTCH1 translocations in breast carcinoma and associated pre-invasive lesions.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23504457 2013 MAST205 competes with cystic fibrosis transmembrane conductance regulator (CFTR)-associated ligand for binding to CFTR to regulate CFTR-mediated fluid transport.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22609064 2012 Transcriptional regulation of human-specific SVAF? retrotransposons by cis-regulatory MAST2 sequences.
22101766 2011 Functionally recurrent rearrangements of the MAST kinase and Notch gene families in breast cancer.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19961423 2009 Novel family of human transposable elements formed due to fusion of the first exon of gene MAST2 with retrotransposon SVA.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19635844 2009 Exon-trapping mediated by the human retrotransposon SVA.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16159897 2006 Coexpression of MAST205 inhibits the activity of Na+/H+ exchanger NHE3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308666 2004 Interaction of TRAF6 with MAST205 regulates NF-kappaB activation and MAST205 stability.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14764729 2004 Microtubule-associated serine/threonine kinase-205 kDa and Fc gamma receptor control IL-12 p40 synthesis and NF-kappa B activation.
14760703 2004 Proteomic identification of brain proteins that interact with dynein light chain LC8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12421765 2002 Protein-protein interactions between large proteins: two-hybrid screening using a functionally classified library composed of long cDNAs.
12117771 2002 Protocadherin LKC, a new candidate for a tumor suppressor of colon and liver cancers, its association with contact inhibition of cell proliferation.
11099500 2001 Interaction of the type IIa Na/Pi cotransporter with PDZ proteins.
10646847 2000 Threonine phosphorylation of the MMAC1/PTEN PDZ binding domain both inhibits and stimulates PDZ binding.
10404183 1999 Interactions between beta 2-syntrophin and a family of microtubule-associated serine/threonine kinases.
9872452 1998 Prediction of the coding sequences of unidentified human genes. XI. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8902215 1996 Increased activity associated with the MAST205 protein kinase complex during mammalian spermiogenesis.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8246979 1993 A novel 205-kilodalton testis-specific serine/threonine protein kinase associated with microtubules of the spermatid manchette.