Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.05
PubTator Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Leprosy 77 3.947 2.0
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 0.000

AA Sequence

MTRITELWSSPQWKVGAEVCGRQMREQRTAEQSETQRTWLSMAATLQFLVCLVVAICLLSGVTTTQPHAG      1 - 70
QPMDSTSVGGGLQEPEAPEVMFELLWAGLELDVMGQLHIQDEELASTHPGRRLRLLLQHHVPSDLEGTEQ     71 - 140
WLQQLQDLRKGPPLSTWDFEHLLLTGLSCVYRLHAASEAEERGRWAQVFALLAQETLWDLCKGFCPQDRP    141 - 210
PSLGSWASILDPFP                                                            211 - 224
//

Text Mined References (2)

PMID Year Title
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.