Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.21
PubTator Score 0.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.5e-23
Disease Target Count Z-score Confidence
Leprosy 73 3.993 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 1.5e-23

AA Sequence

MTRITELWSSPQWKVGAEVCGRQMREQRTAEQSETQRTWLSMAATLQFLVCLVVAICLLSGVTTTQPHAG      1 - 70
QPMDSTSVGGGLQEPEAPEVMFELLWAGLELDVMGQLHIQDEELASTHPGRRLRLLLQHHVPSDLEGTEQ     71 - 140
WLQQLQDLRKGPPLSTWDFEHLLLTGLSCVYRLHAASEAEERGRWAQVFALLAQETLWDLCKGFCPQDRP    141 - 210
PSLGSWASILDPFP                                                            211 - 224
//

Text Mined References (2)

PMID Year Title