Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.15
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
periodontitis -2.100 0.000
Atopic dermatitis -1.600 0.032
ovarian cancer -4.100 0.000

AA Sequence

MGLKALCLGLLCVLFVSHFYTPMPDNIEESWKIMALDAIAKTCTFTAMCFENMRIMRYEEFISMIFRLDY      1 - 70
TQPLSDEYITVTDTTFVDIPVRLYLPKRKSETRRRAVIYFHGGGFCFGSSKQRAFDFLNRWTANTLDAVV     71 - 140
VGVDYRLAPQHHFPAQFEDGLAAVKFFLLEKILTKYGVDPTRICIAGDSSGGNLATAVTQQVQNDAEIKH    141 - 210
KIKMQVLLYPGLQITDSYLPSHRENEHGIVLTRDVAIKLVSLYFTKDEALPWAMRRNQHMPLESRHLFKF    211 - 280
VNWSILLPEKYRKDYVYTEPILGGLSYSLPGLTDSRALPLLANDSQLQNLPLTYILTCQHDLLRDDGLMY    281 - 350
VTRLRNVGVQVVHEHIEDGIHGALSFMTSPFYLRLGLRIRDMYVSWLDKNL                       351 - 401
//

Text Mined References (7)

PMID Year Title
25715734 2015 Isolation and characterization of arylacetamide deacetylase in cynomolgus macaques.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17562024 2007 Large-scale identification of human genes implicated in epidermal barrier function.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.