Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.15
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
periodontitis 293 6.7e-24
ovarian cancer 8520 3.6e-17
Atopic dermatitis 952 3.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Aggressive Periodontitis 12 3.91 2.0

Expression

  Differential Expression (3)

Disease log2 FC p
Atopic dermatitis -1.600 3.2e-02
ovarian cancer -4.100 3.6e-17
periodontitis -2.100 6.7e-24

AA Sequence

MGLKALCLGLLCVLFVSHFYTPMPDNIEESWKIMALDAIAKTCTFTAMCFENMRIMRYEEFISMIFRLDY      1 - 70
TQPLSDEYITVTDTTFVDIPVRLYLPKRKSETRRRAVIYFHGGGFCFGSSKQRAFDFLNRWTANTLDAVV     71 - 140
VGVDYRLAPQHHFPAQFEDGLAAVKFFLLEKILTKYGVDPTRICIAGDSSGGNLATAVTQQVQNDAEIKH    141 - 210
KIKMQVLLYPGLQITDSYLPSHRENEHGIVLTRDVAIKLVSLYFTKDEALPWAMRRNQHMPLESRHLFKF    211 - 280
VNWSILLPEKYRKDYVYTEPILGGLSYSLPGLTDSRALPLLANDSQLQNLPLTYILTCQHDLLRDDGLMY    281 - 350
VTRLRNVGVQVVHEHIEDGIHGALSFMTSPFYLRLGLRIRDMYVSWLDKNL                       351 - 401
//

Text Mined References (7)

PMID Year Title