Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.25
PubTator Score 0.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6P050
Symbols Fbl22

Gene

Gene RIF (1)

PMID Text
22972877 Fbxl22 promotes the proteasome-dependent degradation of sarcomeric proteins and is essential for maintenance of normal contractile function.

AA Sequence

MWPLLTMHITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSLTELQKDNFLLGPA      1 - 70
LRSLSICWHSSRVQVCSIEDWLKSAFQRSICSRHESLVNDFLLRVCDRLSAVRSPRRREAPAPSSGTPIA     71 - 140
VGPKSPRWGGPDHSEFADLRSGVTGARAAARRGLGSLRAERPSETPPAPGVSWGPPPPGAPVVISVKQEE    141 - 210
GKQGRTGRRSHRAAPPCGFARTRVCPPTFPGADAFPQ                                     211 - 247
//

Text Mined References (11)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
22972877 2012 F-box and leucine-rich repeat protein 22 is a cardiac-enriched F-box protein that regulates sarcomeric protein turnover and is essential for maintenance of contractile function in vivo.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16381901 2006 The LIFEdb database in 2006.
15520277 2004 Systematic analysis and nomenclature of mammalian F-box proteins.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...