Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.84
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.500 1.0e-02
atypical teratoid/rhabdoid tumor 1.300 1.2e-04
glioblastoma 1.400 5.3e-03
group 3 medulloblastoma 1.700 6.7e-03
malignant mesothelioma 1.300 2.9e-05
Multiple myeloma 1.323 4.1e-03
osteosarcoma -1.930 4.4e-06
ovarian cancer -1.300 4.5e-06

Gene RIF (2)

AA Sequence

MAAEVYFGDLELFEPFDHPEESIPKPVHTRFKDDDGDEEDENGVGDAELRERLRQCEETIEQLRAENQEL      1 - 70
KRKLNILTRPSGILVNDTKLDGPILQILFMNNAISKQYHQEIEEFVSNLVKRFEEQQKNDVEKTSFNLLP     71 - 140
QPSSIVLEEDHKVEESCAIKNNKEAFSVVGSVLYFTNFCLDKLGQPLLNENPQLSEGWEIPKYHQVFSHI    141 - 210
VSLEGQEIQVKAKRPKPHCFNCGSEEHQMKDCPMPRNAARISEKRKEYMDACGEANNQNFQQRYHAEEVE    211 - 280
ERFGRFKPGVISEELQDALGVTDKSLPPFIYRMRQLGYPPGWLKEAELENSGLALYDGKDGTDGETEVGE    281 - 350
IQQNKSVTYDLSKLVNYPGFNISTPRGIPDEWRIFGSIPMQACQQKDVFANYLTSNFQAPGVKSGNKRSS    351 - 420
SHSSPGSPKKQKNESNSAGSPADMELDSDMEVPHGSQSSESFQFQPPLPPDTPPLPRGTPPPVFTPPLPK    421 - 490
GTPPLTPSDSPQTRTASGAVDEDALTLEELEEQQRRIWAALEQAESVNSDSDVPVDTPLTGNSVASSPCP    491 - 560
NELDLPVPEGKTSEKQTLDEPEVPEIFTKKSEAGHASSPDSEVTSLCQKEKAELAPVNTEGALLDNGSVV    561 - 630
PNCDISNGGSQKLFPADTSPSTATKIHSPIPDMSKFATGITPFEFENMAESTGMYLRIRSLLKNSPRNQQ    631 - 700
KNKKASE                                                                   701 - 707
//

Text Mined References (28)

PMID Year Title