Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.84
PubTator Score 3.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.323 0.004
malignant mesothelioma 1.300 0.000
osteosarcoma -1.930 0.000
group 3 medulloblastoma 1.700 0.007
astrocytoma 1.500 0.010
glioblastoma 1.400 0.005
atypical teratoid/rhabdoid tumor 1.300 0.000
ovarian cancer -1.300 0.000

Synonym

Accession Q6NZY4 Q7L2P6 Q8N2K5 Q96SK7 Q9NSS2 Q9NSS3
Symbols

Gene

PANTHER Protein Class (1)

Gene RIF (1)

PMID Text
16263084 Zcchc8 is a glycogen synthase kinase-3 substrate with a role in RNA metabolism

AA Sequence

MAAEVYFGDLELFEPFDHPEESIPKPVHTRFKDDDGDEEDENGVGDAELRERLRQCEETIEQLRAENQEL      1 - 70
KRKLNILTRPSGILVNDTKLDGPILQILFMNNAISKQYHQEIEEFVSNLVKRFEEQQKNDVEKTSFNLLP     71 - 140
QPSSIVLEEDHKVEESCAIKNNKEAFSVVGSVLYFTNFCLDKLGQPLLNENPQLSEGWEIPKYHQVFSHI    141 - 210
VSLEGQEIQVKAKRPKPHCFNCGSEEHQMKDCPMPRNAARISEKRKEYMDACGEANNQNFQQRYHAEEVE    211 - 280
ERFGRFKPGVISEELQDALGVTDKSLPPFIYRMRQLGYPPGWLKEAELENSGLALYDGKDGTDGETEVGE    281 - 350
IQQNKSVTYDLSKLVNYPGFNISTPRGIPDEWRIFGSIPMQACQQKDVFANYLTSNFQAPGVKSGNKRSS    351 - 420
SHSSPGSPKKQKNESNSAGSPADMELDSDMEVPHGSQSSESFQFQPPLPPDTPPLPRGTPPPVFTPPLPK    421 - 490
GTPPLTPSDSPQTRTASGAVDEDALTLEELEEQQRRIWAALEQAESVNSDSDVPVDTPLTGNSVASSPCP    491 - 560
NELDLPVPEGKTSEKQTLDEPEVPEIFTKKSEAGHASSPDSEVTSLCQKEKAELAPVNTEGALLDNGSVV    561 - 630
PNCDISNGGSQKLFPADTSPSTATKIHSPIPDMSKFATGITPFEFENMAESTGMYLRIRSLLKNSPRNQQ    631 - 700
KNKKASE                                                                   701 - 707
//

Text Mined References (23)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22817747 2012 Comparison of the yeast and human nuclear exosome complexes.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21855801 2011 Interaction profiling identifies the human nuclear exosome targeting complex.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...