Property Summary

NCBI Gene PubMed Count 49
PubMed Score 101.80
PubTator Score 61.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Crohn's disease 321 0.0 0.8
Disease Target Count Z-score Confidence
congenital generalized lipodystrophy 10 0.0 4.0
diabetes mellitus 1728 0.0 4.0
Disease Target Count Z-score Confidence
Lipodystrophy 40 5.152 2.6
Myopathy 185 3.736 1.9
Acanthosis Nigricans 27 3.223 1.6

Expression

  Differential Expression (29)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.700 8.8e-05
Breast cancer -1.600 2.9e-10
breast carcinoma -1.200 3.5e-05
colon cancer -1.400 7.7e-04
cutaneous lupus erythematosus -1.100 3.0e-02
ductal carcinoma in situ -2.000 1.9e-04
ependymoma 2.100 4.2e-12
fibroadenoma -1.100 6.0e-03
gastric carcinoma 1.500 4.9e-02
glioblastoma 1.600 2.0e-03
group 4 medulloblastoma -1.100 1.5e-02
intraductal papillary-mucinous adenoma (... -1.700 2.5e-05
intraductal papillary-mucinous carcinoma... -1.700 2.7e-04
intraductal papillary-mucinous neoplasm ... -1.500 1.1e-03
invasive ductal carcinoma -2.100 9.1e-04
lung adenocarcinoma -1.300 3.0e-19
lung cancer -1.600 5.9e-04
lung carcinoma -1.600 6.5e-14
malignant mesothelioma -1.200 1.0e-05
non-small cell lung cancer -1.021 2.5e-13
osteosarcoma 2.545 6.3e-03
ovarian cancer -2.400 4.8e-08
pancreatic cancer 1.600 2.8e-03
pediatric high grade glioma 1.100 2.4e-03
Pick disease 1.100 1.3e-03
primary pancreatic ductal adenocarcinoma 1.609 3.9e-03
psoriasis -1.400 1.5e-04
ulcerative colitis 1.500 5.8e-05
urothelial carcinoma 1.600 4.1e-02

Gene RIF (35)

AA Sequence

MEDPTLYIVERPLPGYPDAEAPEPSSAGAQAAEEPSGAGSEELIKSDQVNGVLVLSLLDKIIGAVDQIQL      1 - 70
TQAQLEERQAEMEGAVQSIQGELSKLGKAHATTSNTVSKLLEKVRKVSVNVKTVRGSLERQAGQIKKLEV     71 - 140
NEAELLRRRNFKVMIYQDEVKLPAKLSISKSLKESEALPEKEGEELGEGERPEEDAAALELSSDEAVEVE    141 - 210
EVIEESRAERIKRSGLRRVDDFKKAFSKEKMEKTKVRTRENLEKTRLKTKENLEKTRHTLEKRMNKLGTR    211 - 280
LVPAERREKLKTSRDKLRKSFTPDHVVYARSKTAVYKVPPFTFHVKKIREGQVEVLKATEMVEVGADDDE    281 - 350
GGAERGEAGDLRRGSSPDVHALLEITEESDAVLVDKSDSD                                  351 - 390
//

Text Mined References (64)

PMID Year Title