Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.21
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -5.800 0.000
cutaneous lupus erythematosus 2.100 0.001
osteosarcoma 1.840 0.006
cystic fibrosis 2.152 0.000
non-small cell lung cancer 1.207 0.000
breast carcinoma -1.100 0.004
lung adenocarcinoma 1.200 0.005
psoriasis 1.500 0.000

Gene RIF (1)

PMID Text
25053991 STEAP1B transcripts have similar structural features to STEAP1, but may encode proteins with less transmembrane domains. STEAP1B2 transcript is also overexpressed on neoplastic prostate, making it worth to evaluate its potential as cancer biomarker

AA Sequence

MESRKDITNQEEIWKMKPRRNLEDNDYLQTAHADEFDCPSELQHAQELFPQWHLPIKIAAVMASLTFLYT      1 - 70
LLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQVHNGTKYKKFPHWLDKWML     71 - 140
TRKQFGLLSLFFAVLHAIYTLSYAMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAI    141 - 210
LALLAVTSIPSVSDSLTWREFHYIQVHGRINFLTL                                       211 - 245
//

Text Mined References (7)

PMID Year Title
25053991 2014 Expression of STEAP1 and STEAP1B in prostate cell lines, and the putative regulation of STEAP1 by post-transcriptional and post-translational mechanisms.
21546767 2011 Genome-wide association scan for survival on dialysis in African-Americans with type 2 diabetes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.