Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.21
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
breast carcinoma -1.100 4.0e-03
cutaneous lupus erythematosus 2.100 6.1e-04
cystic fibrosis 2.152 7.7e-07
lung adenocarcinoma 1.200 4.8e-03
malignant mesothelioma -5.800 8.2e-10
non-small cell lung cancer 1.207 2.1e-07
osteosarcoma 1.840 6.5e-03
psoriasis 1.500 1.9e-34

Gene RIF (1)

AA Sequence

MESRKDITNQEEIWKMKPRRNLEDNDYLQTAHADEFDCPSELQHAQELFPQWHLPIKIAAVMASLTFLYT      1 - 70
LLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQVHNGTKYKKFPHWLDKWML     71 - 140
TRKQFGLLSLFFAVLHAIYTLSYAMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAI    141 - 210
LALLAVTSIPSVSDSLTWREFHYIQVHGRINFLTL                                       211 - 245
//

Text Mined References (7)

PMID Year Title