Property Summary

NCBI Gene PubMed Count 13
Grant Count 5
Funding $679,945.67
PubMed Score 5.26
PubTator Score 5.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.336 0.000
atypical teratoid / rhabdoid tumor 1.600 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.100 0.003
pediatric high grade glioma 1.100 0.000
ovarian cancer 1.100 0.000

Gene RIF (5)

PMID Text
26318859 Data suggest Rev1 protein recognition mechanism by Fanconi anemia-associated protein 20 (FAAP20).
25414354 FAAP20-ubiquitin interaction expands beyond the compact UBZ domain and requires the folding and interaction of the otherwise disordered C-terminal tail of FAAP20 for high-affinity binding.
22705371 Data indicate that RNF8 and FAAP20 (C1orf86) are needed for efficient Fanconi anemia group D2 protein FANCD2 monoubiquitination.
22396592 FAAP20 is an important player involved in the Fanconi anemia pathway
22343915 FAAP20 contains a conserved ubiquitin-binding zinc-finger domain and binds K-63-linked ubiquitin chains in vitro. The FAAP20-UBZ domain is not required for interaction with FANCA, but is required for DNA-damage-induced chromatin loading of FANCA and the functional integrity of the Fanconi anemia pathway.

AA Sequence

MEAARRPRLGLSRRRPRPAGGPSGGRPWFLLGGDERERLWAELLRTVSPELILDHEVPSLPAFPGQEPRC      1 - 70
GPEPTEVFTVGPKTFSWTPFPPDLWGPGRSYRLLHGAGGHLESPARSLPQRPAPDPCRAPRVEQQPSVEG     71 - 140
AAALRSCPMCQKEFAPRLTQLDVDSHLAQCLAESTEDVTW                                  141 - 180
//

Text Mined References (17)

PMID Year Title
26318859 2015 Biophysical characterization of the interaction between FAAP20-UBZ4 domain and Rev1-BRCT domain.
25414354 2014 Ubiquitin recognition by FAAP20 expands the complex interface beyond the canonical UBZ domain.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22705371 2012 A ubiquitin-binding protein, FAAP20, links RNF8-mediated ubiquitination to the Fanconi anemia DNA repair network.
22396592 2012 Fanconi anemia (FA) binding protein FAAP20 stabilizes FA complementation group A (FANCA) and participates in interstrand cross-link repair.
22343915 2012 FAAP20: a novel ubiquitin-binding FA nuclear core-complex protein required for functional integrity of the FA-BRCA DNA repair pathway.
22266823 2012 Regulation of Rev1 by the Fanconi anemia core complex.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
More...