Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.19
PubTator Score 6.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 6.19653190886682E-19
pilocytic astrocytoma 3086 3.81326905721959E-13
juvenile dermatomyositis 1189 2.44184527648339E-11
Duchenne muscular dystrophy 602 5.57887136060547E-9
posterior fossa group A ependymoma 1511 5.96525693249948E-8
pediatric high grade glioma 2712 7.28519532687126E-8
ulcerative colitis 2087 3.7888479396675E-6
glioblastoma 5572 1.65796289932041E-5
group 3 medulloblastoma 2254 2.29846607659778E-5
atypical teratoid / rhabdoid tumor 4369 1.17035642999333E-4
primitive neuroectodermal tumor 3031 1.45606350290163E-4
primary Sjogren syndrome 789 3.80118089022135E-4
osteosarcoma 7933 7.04933740611381E-4
ovarian cancer 8492 0.00119261612084845
pancreatic cancer 2300 0.00519660878182519
primary pancreatic ductal adenocarcinoma 1271 0.00878072062015042
subependymal giant cell astrocytoma 2287 0.0109050684270181
interstitial cystitis 2299 0.0208074973296542
gastric carcinoma 832 0.0239189887322703
Disease Target Count Z-score Confidence
Nonsyndromic deafness 121 3.63 1.8

Expression

Synonym

Gene

  Ortholog (8)

Gene RIF (4)

PMID Text
21804078 phostensin is a ubiquitous protein in leukocytes, and it may play an important role in modulating the cellular functions of leukocytes.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19622346 phostensin is an actin filament pointed end-capping protein that is capable of modulating actin dynamics.
17374523 our data shows that phostensin targets PP1 to F-actin cytoskeleton.

AA Sequence

MATIPDWKLQLLARRRQEEASVRGREKAERERLSQMPAWKRGLLERRRAKLGLSPGEPSPVLGTVEAGPP      1 - 70
DPDESAVLLEAIGPVHQNRFIRQERQQQQQQQQRSEELLAERKPGPLEARERRPSPGEMRDQSPKGRESR     71 - 140
EERLSPRETRERRLGIGGAQELSLRPLEARDWRQSPGEVGDRSSRLSEAWKWRLSPGETPERSLRLAESR    141 - 210
EQSPRRKEVESRLSPGESAYQKLGLTEAHKWRPDSRESQEQSLVQLEATEWRLRSGEERQDYSEECGRKE    211 - 280
EWPVPGVAPKETAELSETLTREAQGNSSAGVEAAEQRPVEDGERGMKPTEGWKWTLNSGKAREWTPRDIE    281 - 350
AQTQKPEPPESAEKLLESPGVEAGEGEAEKEEAGAQGRPLRALQNCCSVPSPLPPEDAGTGGLRQQEEEA    351 - 420
VELQPPPPAPLSPPPPAPTAPQPPGDPLMSRLFYGVKAGPGVGAPRRSGHTFTVNPRRSVPPATPATPTS    421 - 490
PATVDAAVPGAGKKRYPTAEEILVLGGYLRLSRSCLAKGSPERHHKQLKISFSETALETTYQYPSESSVL    491 - 560
EELGPEPEVPSAPNPPAAQPDDEEDEEELLLLQPELQGGLRTKALIVDESCRR                     561 - 613
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24434620 2014 Identification of the high molecular weight isoform of phostensin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21804078 2011 Immunolocalization of phostensin in lymphatic cells and tissues.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...