Property Summary

NCBI Gene PubMed Count 18
PubMed Score 6.98
PubTator Score 6.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 1.500 3.2e-05
Astrocytoma, Pilocytic 2.300 4.9e-13
atypical teratoid / rhabdoid tumor 1.300 1.2e-04
Duchenne muscular dystrophy 1.025 5.6e-09
gastric carcinoma 1.300 2.4e-02
glioblastoma 1.700 2.7e-09
group 3 medulloblastoma 1.900 2.3e-05
interstitial cystitis 1.300 2.1e-02
juvenile dermatomyositis 1.258 2.4e-11
lung carcinoma -1.200 6.2e-19
osteosarcoma 1.200 7.0e-04
ovarian cancer 1.500 1.2e-03
pancreatic cancer 1.700 5.2e-03
posterior fossa group A ependymoma 1.200 6.0e-08
primary pancreatic ductal adenocarcinoma 1.705 8.8e-03
primary Sjogren syndrome 1.200 3.8e-04
primitive neuroectodermal tumor 1.500 1.5e-04
subependymal giant cell astrocytoma 1.469 1.1e-02
ulcerative colitis 2.000 3.8e-06

Gene RIF (4)

AA Sequence

MATIPDWKLQLLARRRQEEASVRGREKAERERLSQMPAWKRGLLERRRAKLGLSPGEPSPVLGTVEAGPP      1 - 70
DPDESAVLLEAIGPVHQNRFIRQERQQQQQQQQRSEELLAERKPGPLEARERRPSPGEMRDQSPKGRESR     71 - 140
EERLSPRETRERRLGIGGAQELSLRPLEARDWRQSPGEVGDRSSRLSEAWKWRLSPGETPERSLRLAESR    141 - 210
EQSPRRKEVESRLSPGESAYQKLGLTEAHKWRPDSRESQEQSLVQLEATEWRLRSGEERQDYSEECGRKE    211 - 280
EWPVPGVAPKETAELSETLTREAQGNSSAGVEAAEQRPVEDGERGMKPTEGWKWTLNSGKAREWTPRDIE    281 - 350
AQTQKPEPPESAEKLLESPGVEAGEGEAEKEEAGAQGRPLRALQNCCSVPSPLPPEDAGTGGLRQQEEEA    351 - 420
VELQPPPPAPLSPPPPAPTAPQPPGDPLMSRLFYGVKAGPGVGAPRRSGHTFTVNPRRSVPPATPATPTS    421 - 490
PATVDAAVPGAGKKRYPTAEEILVLGGYLRLSRSCLAKGSPERHHKQLKISFSETALETTYQYPSESSVL    491 - 560
EELGPEPEVPSAPNPPAAQPDDEEDEEELLLLQPELQGGLRTKALIVDESCRR                     561 - 613
//

Text Mined References (28)

PMID Year Title