Property Summary

NCBI Gene PubMed Count 40
Grant Count 108
R01 Count 60
Funding $16,797,620.88
PubMed Score 616.40
PubTator Score 101.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma -1.400 0.000
osteosarcoma -1.578 0.001
glioblastoma 1.400 0.002
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma, large-cell -1.100 0.015
lung cancer -1.400 0.015
adult high grade glioma -1.200 0.005
group 3 medulloblastoma 1.500 0.008
non primary Sjogren syndrome sicca 1.200 0.023
psoriasis -1.200 0.000
acute myeloid leukemia 1.300 0.040
ovarian cancer 3.200 0.000

Synonym

Accession Q6NYC1 B3KMN8 B4DGX1 Q86VY0 Q8IUM5 Q9Y4E2
Symbols PSR
PTDSR
PTDSR1

Gene

PANTHER Protein Class (1)

PDB

3K2O   3LD8   3LDB  

Gene RIF (23)

PMID Text
26645717 Our studies identify JMJD6 as a molecular determinant of cancer stem cell phenotype
26037477 A novel role for JMJD6 as an oxygen sensor in the human placenta, and alterations in the JMJD6-VHL-HIF1A feedback loop may indirectly contribute to elevated HIF1A found in preeclampsia.
25951181 Although JMJD6 displays anti-tumoral properties in cell lines, its expression in breast tumours may be a marker of poor prognosis, suggesting that its function could be altered in breast cancer
25219359 The expression of JMJD6 was reduced in T lymphocytes in chronic hepatitis B.
24667498 JMJD6 is a potential biomarker for colon cancer aggressiveness and a potential target for colon cancer intervention.
24360279 Study reports that a unique cohort of JMJD6 and Brd4 cobound distal enhancers, termed anti-pause enhancers, regulate promoter-proximal pause release of a large subset of transcription units via long-range interactions.
23688307 The structure of Jmjd6 oligomers in vitro changes in the absence of the polyS domain, possibly reflecting the role of the polyS domain in nuclear/nucleolar shuttling of Jmjd6.
23595221 results showed that JMJD6 plays a key role in lung adenocarcinoma and therefore may provide an opportunity for developing a novel therapeutic target as well as a prognostic marker in lung adenocarcinoma.
23303181 histones are additional substrates of JMJD6 in vivo. Because 5-hydroxylation of lysyl residues inhibited N-acetylation and N-methylation by an acetyltransferase and a methyltransferase
22701020 Endothelial microparticles are incorporated by endothelial cells in an annexin I/phosphatidylserine receptor-dependent manner and protect target cells against apoptosis.
More...

AA Sequence

MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPV      1 - 70
VLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSYGEH     71 - 140
PKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFP    141 - 210
TSTPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDT    211 - 280
TIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSS    281 - 350
SSSSSDSDSECESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSR                     351 - 403
//

Text Mined References (44)

PMID Year Title
26645717 2016 Elevated expression of JMJD6 is associated with oral carcinogenesis and maintains cancer stemness properties.
26037477 2015 Jumonji Domain Containing Protein 6: A Novel Oxygen Sensor in the Human Placenta.
25951181 2015 Role of JMJD6 in Breast Tumourigenesis.
25416956 2014 A proteome-scale map of the human interactome network.
25219359 2014 Regulation of T cell proliferation by JMJD6 and PDGF-BB during chronic hepatitis B infection.
24667498 2014 JMJD6 promotes colon carcinogenesis through negative regulation of p53 by hydroxylation.
24360279 2013 Brd4 and JMJD6-associated anti-pause enhancers in regulation of transcriptional pause release.
23776548 2013 Genetic loci for retinal arteriolar microcirculation.
23688307 2013 The polyserine domain of the lysyl-5 hydroxylase Jmjd6 mediates subnuclear localization.
23595221 2013 High expression of JMJD6 predicts unfavorable survival in lung adenocarcinoma.
More...