Property Summary

NCBI Gene PubMed Count 40
PubMed Score 616.40
PubTator Score 101.74

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma -1.400 1.0e-08
osteosarcoma -1.578 5.8e-04
glioblastoma 1.400 2.2e-03
atypical teratoid / rhabdoid tumor -1.600 1.8e-04
medulloblastoma, large-cell -1.100 1.5e-02
lung cancer -1.400 1.5e-02
adult high grade glioma -1.200 5.2e-03
group 3 medulloblastoma 1.500 8.5e-03
non primary Sjogren syndrome sicca 1.200 2.3e-02
psoriasis -1.200 2.3e-08
acute myeloid leukemia 1.300 4.0e-02
ovarian cancer 3.200 4.9e-09

Gene RIF (23)

PMID Text
26645717 Our studies identify JMJD6 as a molecular determinant of cancer stem cell phenotype
26037477 A novel role for JMJD6 as an oxygen sensor in the human placenta, and alterations in the JMJD6-VHL-HIF1A feedback loop may indirectly contribute to elevated HIF1A found in preeclampsia.
25951181 Although JMJD6 displays anti-tumoral properties in cell lines, its expression in breast tumours may be a marker of poor prognosis, suggesting that its function could be altered in breast cancer
25219359 The expression of JMJD6 was reduced in T lymphocytes in chronic hepatitis B.
24667498 JMJD6 is a potential biomarker for colon cancer aggressiveness and a potential target for colon cancer intervention.
24360279 Study reports that a unique cohort of JMJD6 and Brd4 cobound distal enhancers, termed anti-pause enhancers, regulate promoter-proximal pause release of a large subset of transcription units via long-range interactions.
23688307 The structure of Jmjd6 oligomers in vitro changes in the absence of the polyS domain, possibly reflecting the role of the polyS domain in nuclear/nucleolar shuttling of Jmjd6.
23595221 results showed that JMJD6 plays a key role in lung adenocarcinoma and therefore may provide an opportunity for developing a novel therapeutic target as well as a prognostic marker in lung adenocarcinoma.
23303181 histones are additional substrates of JMJD6 in vivo. Because 5-hydroxylation of lysyl residues inhibited N-acetylation and N-methylation by an acetyltransferase and a methyltransferase
22701020 Endothelial microparticles are incorporated by endothelial cells in an annexin I/phosphatidylserine receptor-dependent manner and protect target cells against apoptosis.
22621393 data indicate JMJD6 has conserved functions and often affects similar pathways across multiple cell types; it has ability to promote cancer cell proliferation and motility; JMJD6 is a novel biomarker of tumor aggressiveness with functional implications in breast cancer growth and migration
22189873 we did not detect arginine demethylase activity for Jmjd6, but we did confirm that it could catalyze the lysyl-hydroxylation of histone peptides
21300889 Jmjd6 regulates the splicing of Flt1, thereby controlling angiogenic sprouting.
20684070 crystallographic studies on the catalytic domain of JMJD6 in complex with Ni(II) substituting for Fe(II)
20679243 Data show that JMJD6 bound efficiently to single-stranded RNA, but not to single-stranded DNA, double-stranded RNA, or double-stranded DNA.
19574390 study reveals the splicing factor U2AF65 undergoes posttranslational lysyl-5-hydroxylation catalyzed by Jmjd6; Jmjd6 is shown to change alternative RNA splicing of some endogenous & reporter genes, supporting a role for Jmjd6 in regulation of RNA splicing
19492415 Jmjd6 serves as a membrane-associated receptor that regulates phagocytosis in immature macrophages but is dispensable for phagocytosis.
18564434 Jmjd6 is predicted to have a conserved enzymatic function as a classical non-heme, Fe(II)- and 2OG-dependent dioxygenase, and is closely related to the JmjC domain-containing proteins Jmjd4 and JFP6.
17947579 study demonstrates that JMJD6 is a JmjC-containing iron- and 2-oxoglutarate-dependent dioxygenase that demethylates histone H3 at arginine 2 (H3R2) and histone H4 at arginine 3 (H4R3) in both biochemical and cell-based assays
17534701 Homomultimer of PS-R might be playing an important function as a scaffolding protein in the nucleus.
15345036 The mouse ortholog of Ptdsr is essential for the development and differentiation of multiple organs during embryogenesis but not for apoptotic cell clearance.
15072554 plays a major role in the clearance of apoptotic cells from the thymus.
11877474 Elastase-mediated phosphatidylserine receptor cleavage impairs apoptotic cell clearance in cystic fibrosis and bronchiectasis.

AA Sequence

MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPV      1 - 70
VLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEYMESTRDDSPLYIFDSSYGEH     71 - 140
PKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPPRSGTGIHIDPLGTSAWNALVQGHKRWCLFP    141 - 210
TSTPRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDT    211 - 280
TIAITQNFASSTNFPVVWHKTVRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSS    281 - 350
SSSSSDSDSECESGSEGDGTVHRRKKRRTCSMVGNGDTTSQDDCVSKERSSSR                     351 - 403
//

Text Mined References (44)

PMID Year Title
26645717 2016 Elevated expression of JMJD6 is associated with oral carcinogenesis and maintains cancer stemness properties.
26037477 2015 Jumonji Domain Containing Protein 6: A Novel Oxygen Sensor in the Human Placenta.
25951181 2015 Role of JMJD6 in Breast Tumourigenesis.
25416956 2014 A proteome-scale map of the human interactome network.
25219359 2014 Regulation of T cell proliferation by JMJD6 and PDGF-BB during chronic hepatitis B infection.
24667498 2014 JMJD6 promotes colon carcinogenesis through negative regulation of p53 by hydroxylation.
24360279 2013 Brd4 and JMJD6-associated anti-pause enhancers in regulation of transcriptional pause release.
23776548 2013 Genetic loci for retinal arteriolar microcirculation.
23688307 2013 The polyserine domain of the lysyl-5 hydroxylase Jmjd6 mediates subnuclear localization.
23595221 2013 High expression of JMJD6 predicts unfavorable survival in lung adenocarcinoma.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
23303181 2013 Lysyl 5-hydroxylation, a novel histone modification, by Jumonji domain containing 6 (JMJD6).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22701020 2012 Endothelial microparticle uptake in target cells is annexin I/phosphatidylserine receptor dependent and prevents apoptosis.
22621393 2012 JMJD6 is a driver of cellular proliferation and motility and a marker of poor prognosis in breast cancer.
22189873 2012 The hydroxylation activity of Jmjd6 is required for its homo-oligomerization.
21555454 2011 The Brd4 extraterminal domain confers transcription activation independent of pTEFb by recruiting multiple proteins, including NSD3.
21300889 2011 Jumonji domain-containing protein 6 (Jmjd6) is required for angiogenic sprouting and regulates splicing of VEGF-receptor 1.
21269460 2011 Initial characterization of the human central proteome.
21060799 2010 Analysis of Jmjd6 cellular localization and testing for its involvement in histone demethylation.
20684070 2010 Crystal structure of the 2-oxoglutarate- and Fe(II)-dependent lysyl hydroxylase JMJD6.
20679243 2010 Interaction of JMJD6 with single-stranded RNA.
19574390 2009 Jmjd6 catalyses lysyl-hydroxylation of U2AF65, a protein associated with RNA splicing.
19492415 2009 Endogenous Jmjd6 gene product is expressed at the cell surface and regulates phagocytosis in immature monocyte-like activated THP-1 cells.
18564434 2008 Genomic structure and expression of Jmjd6 and evolutionary analysis in the context of related JmjC domain containing proteins.
17947579 2007 JMJD6 is a histone arginine demethylase.
17534701 2007 Characterization of the biochemical and biophysical properties of the phosphatidylserine receptor (PS-R) gene product.
16983801 2006 JmjC-domain-containing proteins and histone demethylation.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15622002 2005 Phosphatidylserine receptor in chronic pancreatitis: evidence for a macrophage independent role.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15469976 2004 Phosphatidylserine receptor is required for the engulfment of dead apoptotic cells and for normal embryonic development in zebrafish.
15453906 2004 Hide and seek: the secret identity of the phosphatidylserine receptor.
15345036 2004 The phosphatidylserine receptor has essential functions during embryogenesis but not in apoptotic cell removal.
15193161 2004 The phosphatidylserine receptor from Hydra is a nuclear protein with potential Fe(II) dependent oxygenase activity.
15072554 2004 Phosphatidylserine receptor cooperates with high-density lipoprotein receptor in recognition of apoptotic cells by thymic nurse cells.
14729065 2004 Nuclear localization of the phosphatidylserine receptor protein via multiple nuclear localization signals.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645848 2003 Cell corpse engulfment mediated by C. elegans phosphatidylserine receptor through CED-5 and CED-12.
12898702 2003 Phagocytosis of apoptotic inflammatory cells by microglia and its therapeutic implications: termination of CNS autoimmune inflammation and modulation by interferon-beta.
12559004 2003 Effects of phosphatidylserine on p38 mitogen activated protein kinase, cyclic AMP responding element binding protein and nuclear factor-kappaB activation in resting and activated microglial cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10811223 2000 A receptor for phosphatidylserine-specific clearance of apoptotic cells.
9628581 1998 Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.