Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.86
PubTator Score 0.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.300 2.3e-04
atypical teratoid / rhabdoid tumor -1.100 1.7e-05
breast carcinoma -1.900 1.8e-05
ductal carcinoma in situ -1.600 3.8e-04
fibroadenoma -1.700 1.4e-02
glioblastoma -1.200 1.2e-03
invasive ductal carcinoma -1.800 2.8e-03
lung adenocarcinoma -2.800 5.2e-19
lung cancer -1.400 1.7e-03
medulloblastoma, large-cell -1.700 1.5e-05
nephrosclerosis 1.029 4.6e-04
non-small cell lung cancer -2.551 5.1e-33
osteosarcoma -3.624 2.9e-07
psoriasis -1.700 1.7e-04

AA Sequence

MAKFALNQNLPDLGGPRLCPVPAAGGARSPSSPYSVETPYGFHLDLDFLKYIEELERGPAARRAPGPPTS      1 - 70
RRPRAPRPGLAGARSPGAWTSSESLASDDGGAPGILSQGAPSGLLMQPLSPRAPVRNPRVEHTLRETSRR     71 - 140
LELAQTHERAPSPGRGVPRSPRGSGRSSPAPNLAPASPGPAQLQLVREQMAAALRRLRELEDQARTLPEL    141 - 210
QEQVRALRAEKARLLAGRAQPEPDGEAETRPDKLAQLRRLTERLATSERGGRARASPRADSPDGLAAGRS    211 - 280
EGALQVLDGEVGSLDGTPQTREVAAEAVPETREAGAQAVPETREAGVEAAPETVEADAWVTEALLGLPAA    281 - 350
AERELELLRASLEHQRGVSELLRGRLRELEEAREAAEEAAAGARAQLREATTQTPWSCAEKAAQTESPAE    351 - 420
APSLTQESSPGSMDGDRAVAPAGILKSIMKKRDGTPGAQPSSGPKSLQFVGVLNGEYESSSSEDASDSDG    421 - 490
DSENGGAEPPGSSSGSGDDSGGGSDSGTPGPPSGGDIRDPEPEAEAEPQQVAQGRCELSPRLREACVALQ    491 - 560
RQLSRPRGVASDGGAVRLVAQEWFRVSSQRRSQAEPVARMLEGVRRLGPELLAHVVNLADGNGNTALHYS    561 - 630
VSHGNLAIASLLLDTGACEVNRQNRAGYSALMLAALTSVRQEEEDMAVVQRLFCMGDVNAKASQTGQTAL    631 - 700
MLAISHGRQDMVATLLACGADVNAQDADGATALMCASEYGRLDTVRLLLTQPGCDPAILDNEGTSALAIA    701 - 770
LEAEQDEVAALLHAHLSSGQPDTQAGVQRHNLSSLQPPPPRFKKFSCLSLPSSWDYNSCEPSRLAQLTIF    771 - 840
//

Text Mined References (8)

PMID Year Title