Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.24
PubTator Score 0.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
nephrosclerosis 1.029 0.000
psoriasis -1.700 0.000
osteosarcoma -3.624 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.200 0.001
medulloblastoma, large-cell -1.700 0.000
non-small cell lung cancer -2.551 0.000
lung cancer -1.400 0.002
breast carcinoma -1.900 0.000
fibroadenoma -1.700 0.014
adult high grade glioma -1.300 0.000
lung adenocarcinoma -2.800 0.000
ductal carcinoma in situ -1.600 0.000
invasive ductal carcinoma -1.800 0.003

AA Sequence

MAKFALNQNLPDLGGPRLCPVPAAGGARSPSSPYSVETPYGFHLDLDFLKYIEELERGPAARRAPGPPTS      1 - 70
RRPRAPRPGLAGARSPGAWTSSESLASDDGGAPGILSQGAPSGLLMQPLSPRAPVRNPRVEHTLRETSRR     71 - 140
LELAQTHERAPSPGRGVPRSPRGSGRSSPAPNLAPASPGPAQLQLVREQMAAALRRLRELEDQARTLPEL    141 - 210
QEQVRALRAEKARLLAGRAQPEPDGEAETRPDKLAQLRRLTERLATSERGGRARASPRADSPDGLAAGRS    211 - 280
EGALQVLDGEVGSLDGTPQTREVAAEAVPETREAGAQAVPETREAGVEAAPETVEADAWVTEALLGLPAA    281 - 350
AERELELLRASLEHQRGVSELLRGRLRELEEAREAAEEAAAGARAQLREATTQTPWSCAEKAAQTESPAE    351 - 420
APSLTQESSPGSMDGDRAVAPAGILKSIMKKRDGTPGAQPSSGPKSLQFVGVLNGEYESSSSEDASDSDG    421 - 490
DSENGGAEPPGSSSGSGDDSGGGSDSGTPGPPSGGDIRDPEPEAEAEPQQVAQGRCELSPRLREACVALQ    491 - 560
RQLSRPRGVASDGGAVRLVAQEWFRVSSQRRSQAEPVARMLEGVRRLGPELLAHVVNLADGNGNTALHYS    561 - 630
VSHGNLAIASLLLDTGACEVNRQNRAGYSALMLAALTSVRQEEEDMAVVQRLFCMGDVNAKASQTGQTAL    631 - 700
MLAISHGRQDMVATLLACGADVNAQDADGATALMCASEYGRLDTVRLLLTQPGCDPAILDNEGTSALAIA    701 - 770
LEAEQDEVAALLHAHLSSGQPDTQAGVQRHNLSSLQPPPPRFKKFSCLSLPSSWDYNSCEPSRLAQLTIF    771 - 840
//

Text Mined References (8)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
19554261 2009 Kank proteins: structure, functions and diseases.
17996375 2008 Kank proteins: a new family of ankyrin-repeat domain-containing proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.