Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.02
PubTator Score 2.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.726 0.000
chronic lymphosyte leukemia -1.200 0.001
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.600 0.000
medulloblastoma, large-cell -1.700 0.000
pancreatic ductal adenocarcinoma liver m... -1.473 0.001
non-small cell lung cancer -1.358 0.000
pediatric high grade glioma -1.300 0.000
psoriasis -1.100 0.000
ovarian cancer 2.000 0.000

Synonym

Accession Q6NXT6 Q8N2S3 Q9NZK9
Symbols CMVFR
OCLSBG

Gene

Gene RIF (1)

PMID Text
17151244 A perinatal lethal mutation in mouse Tapt1 results in homeotic, posterior-to-anterior transformations of the axial skeleton.

AA Sequence

MAGVGDAAAPGEGGGGGVDGPQRDGRGEAEQPGGSGGQGPPPAPQLTETLGFYESDRRRERRRGRTELSL      1 - 70
LRFLSAELTRGYFLEHNEAKYTERRERVYTCLRIPRELEKLMVFGIFLCLDAFLYVFTLLPLRVFLALFR     71 - 140
LLTLPCYGLRDRRLLQPAQVCDILKGVILVICYFMMHYVDYSMMYHLIRGQSVIKLYIIYNMLEVADRLF    141 - 210
SSFGQDILDALYWTATEPKERKRAHIGVIPHFFMAVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMS    211 - 280
NNFVEIKGSVFKKFEKNNLFQMSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHLWVLFPDVCMVIASEI    281 - 350
AVDIVKHAFITKFNDITADVYSEYRASLAFDLVSSRQKNAYTDYSDSVARRMGFIPLPLAVLLIRVVTSS    351 - 420
IKVQGILSYACVILFYFGLISLKVLNSIVLLGKSCQYVKEAKMEEKLSNPPATCTPGKPSSKSQNKCKPS    421 - 490
QGLSTEENLSASITKQPIHQKENIIPLLVTSNSDQFLTTPDGDEKDITQDNSELKHRSSKKDLLEIDRFT    491 - 560
ICGNRID                                                                   561 - 567
//

Text Mined References (12)

PMID Year Title
26365339 2015 Genetic Defects in TAPT1 Disrupt Ciliogenesis and Cause a Complex Lethal Osteochondrodysplasia.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17151244 2007 Mutation of a ubiquitously expressed mouse transmembrane protein (Tapt1) causes specific skeletal homeotic transformations.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...