Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.02
PubTator Score 2.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 1.10219443555177E-17
psoriasis 6685 2.75329334231465E-12
atypical teratoid / rhabdoid tumor 4369 7.66382358383779E-8
pediatric high grade glioma 2712 1.1410356184254E-5
glioblastoma 5572 1.47288315765876E-5
medulloblastoma, large-cell 6234 2.12707533210994E-5
osteosarcoma 7933 1.77397310429158E-4
ovarian cancer 8492 2.32783092978651E-4
chronic lymphosyte leukemia 232 5.52924518884959E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 7.25505607374091E-4
Disease Target Count Z-score Confidence
Galactosemia 20 3.735 1.9

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma 1.726 0.000
chronic lymphosyte leukemia -1.200 0.001
atypical teratoid / rhabdoid tumor -1.800 0.000
glioblastoma -1.600 0.000
medulloblastoma, large-cell -1.700 0.000
pancreatic ductal adenocarcinoma liver m... -1.473 0.001
non-small cell lung cancer -1.358 0.000
pediatric high grade glioma -1.300 0.000
psoriasis -1.100 0.000
ovarian cancer 2.000 0.000

Synonym

Accession Q6NXT6 Q8N2S3 Q9NZK9
Symbols CMVFR
OCLSBG

Gene

  Ortholog (15)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae EggNOG Inparanoid

 GWAS Trait (1)

Pathway (1)

Gene RIF (1)

PMID Text
17151244 A perinatal lethal mutation in mouse Tapt1 results in homeotic, posterior-to-anterior transformations of the axial skeleton.

AA Sequence

MAGVGDAAAPGEGGGGGVDGPQRDGRGEAEQPGGSGGQGPPPAPQLTETLGFYESDRRRERRRGRTELSL      1 - 70
LRFLSAELTRGYFLEHNEAKYTERRERVYTCLRIPRELEKLMVFGIFLCLDAFLYVFTLLPLRVFLALFR     71 - 140
LLTLPCYGLRDRRLLQPAQVCDILKGVILVICYFMMHYVDYSMMYHLIRGQSVIKLYIIYNMLEVADRLF    141 - 210
SSFGQDILDALYWTATEPKERKRAHIGVIPHFFMAVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMS    211 - 280
NNFVEIKGSVFKKFEKNNLFQMSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHLWVLFPDVCMVIASEI    281 - 350
AVDIVKHAFITKFNDITADVYSEYRASLAFDLVSSRQKNAYTDYSDSVARRMGFIPLPLAVLLIRVVTSS    351 - 420
IKVQGILSYACVILFYFGLISLKVLNSIVLLGKSCQYVKEAKMEEKLSNPPATCTPGKPSSKSQNKCKPS    421 - 490
QGLSTEENLSASITKQPIHQKENIIPLLVTSNSDQFLTTPDGDEKDITQDNSELKHRSSKKDLLEIDRFT    491 - 560
ICGNRID                                                                   561 - 567
//

Text Mined References (12)

PMID Year Title
26365339 2015 Genetic Defects in TAPT1 Disrupt Ciliogenesis and Cause a Complex Lethal Osteochondrodysplasia.
24665060 2014 Genome-wide association study of smoking behaviours among Bangladeshi adults.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17151244 2007 Mutation of a ubiquitously expressed mouse transmembrane protein (Tapt1) causes specific skeletal homeotic transformations.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...