Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.02
PubTator Score 2.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.500 8.8e-04
chronic lymphosyte leukemia -1.200 5.5e-04
glioblastoma -1.100 1.4e-03
medulloblastoma, large-cell -1.600 1.5e-04
non-small cell lung cancer -1.001 4.4e-16
osteosarcoma 1.726 1.8e-04
ovarian cancer -1.500 9.5e-05
pancreatic ductal adenocarcinoma liver m... -1.189 3.7e-03
pediatric high grade glioma -1.300 1.1e-05
psoriasis -1.100 2.8e-12

Gene RIF (1)

AA Sequence

MAGVGDAAAPGEGGGGGVDGPQRDGRGEAEQPGGSGGQGPPPAPQLTETLGFYESDRRRERRRGRTELSL      1 - 70
LRFLSAELTRGYFLEHNEAKYTERRERVYTCLRIPRELEKLMVFGIFLCLDAFLYVFTLLPLRVFLALFR     71 - 140
LLTLPCYGLRDRRLLQPAQVCDILKGVILVICYFMMHYVDYSMMYHLIRGQSVIKLYIIYNMLEVADRLF    141 - 210
SSFGQDILDALYWTATEPKERKRAHIGVIPHFFMAVLYVFLHAILIMVQATTLNVAFNSHNKSLLTIMMS    211 - 280
NNFVEIKGSVFKKFEKNNLFQMSNSDIKERFTNYVLLLIVCLRNMEQFSWNPDHLWVLFPDVCMVIASEI    281 - 350
AVDIVKHAFITKFNDITADVYSEYRASLAFDLVSSRQKNAYTDYSDSVARRMGFIPLPLAVLLIRVVTSS    351 - 420
IKVQGILSYACVILFYFGLISLKVLNSIVLLGKSCQYVKEAKMEEKLSNPPATCTPGKPSSKSQNKCKPS    421 - 490
QGLSTEENLSASITKQPIHQKENIIPLLVTSNSDQFLTTPDGDEKDITQDNSELKHRSSKKDLLEIDRFT    491 - 560
ICGNRID                                                                   561 - 567
//

Text Mined References (12)

PMID Year Title