Property Summary

NCBI Gene PubMed Count 16
Grant Count 1
Funding $4,052.25
PubMed Score 9.88
PubTator Score 7.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.300 0.002
ovarian cancer 1.600 0.001

Synonym

Accession Q6NXT4 A5YM45 B7Z901 Q8N5C9 Q96NC3 ZnT-6
Symbols ZNT6
MST103
MSTP103

Gene

PANTHER Protein Class (1)

 Grant Application (1)

Gene RIF (9)

PMID Text
25284286 results of this study suggested that ZnT6 protein levels are decreased in the spinal cords of sporadic ALS patients.
22349685 The results of this study showed that signi fi cant positive correlations between ZIP1,ZnT1, and ZnT6 in most brain in patient with Alzheimer's disease.
20877624 Observational study of gene-disease association. (HuGE Navigator)
19759014 The cytosolic C-terminal tail of ZnT5 is important for its interaction with ZnT6 as a heterodimer.
19371353 our results suggest that alterations in Zn transport proteins ZnT-1, ZnT-4 and ZnT-6 may contribute to the pathology observed in preclinical Alzheimer's disease subjects before onset of clinical symptoms
19064571 Observational study of gene-disease association. (HuGE Navigator)
18639746 Data show that ZNT6 is extensively present in the Abeta-positive plaques in the cortex of human AD brains.
17971500 hZnT-6 is up-regulated in response to cellular zinc depletion in Raji & THP-1 cells.
16580781 Our results show that Zn transporter-4 and Zn transporter-6 are significantly (P<0.05) increased in hippocampus/parahippocampal gyrus of early Alzheimer's disease and Alzheimer's disease subjects.

AA Sequence

MGTIHLFRKPQRSFFGKLLREFRLVAADRRSWKILLFGVINLICTGFLLMWCSSTNSIALTAYTYLTIFD      1 - 70
LFSLMTCLISYWVTLRKPSPVYSFGFERLEVLAVFASTVLAQLGALFILKESAERFLEQPEIHTGRLLVG     71 - 140
TFVALCFNLFTMLSIRNKPFAYVSEAASTSWLQEHVADLSRSLCGIIPGLSSIFLPRMNPFVLIDLAGAF    141 - 210
ALCITYMLIEINNYFAVDTASAIAIALMTFGTMYPMSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVL    211 - 280
EVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANV    281 - 350
LNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPY    351 - 420
SSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP                                 421 - 461
//

Text Mined References (22)

PMID Year Title
25284286 2015 Zinc transporters ZnT3 and ZnT6 are downregulated in the spinal cords of patients with sporadic amyotrophic lateral sclerosis.
24182552 2014 Novel gene variants predict serum levels of the cytokines IL-18 and IL-1ra in older adults.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22349685 2012 Zinc transporter mRNA levels in Alzheimer's disease postmortem brain.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19759014 2009 Demonstration and characterization of the heterodimerization of ZnT5 and ZnT6 in the early secretory pathway.
19371353 2010 Alterations of zinc transporter proteins ZnT-1, ZnT-4 and ZnT-6 in preclinical Alzheimer's disease brain.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
More...