Property Summary

NCBI Gene PubMed Count 18
PubMed Score 9.80
PubTator Score 7.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Alzheimer Disease 83 0.0 0.0
Disease Target Count
Alzheimer's disease 658
Disease Target Count P-value
ovarian cancer 8520 6.0e-04
diabetes mellitus 1728 2.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.300 2.0e-03
ovarian cancer 1.600 6.0e-04

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (11)

AA Sequence

MGTIHLFRKPQRSFFGKLLREFRLVAADRRSWKILLFGVINLICTGFLLMWCSSTNSIALTAYTYLTIFD      1 - 70
LFSLMTCLISYWVTLRKPSPVYSFGFERLEVLAVFASTVLAQLGALFILKESAERFLEQPEIHTGRLLVG     71 - 140
TFVALCFNLFTMLSIRNKPFAYVSEAASTSWLQEHVADLSRSLCGIIPGLSSIFLPRMNPFVLIDLAGAF    141 - 210
ALCITYMLIEINNYFAVDTASAIAIALMTFGTMYPMSVYSGKVLLQTTPPHVIGQLDKLIREVSTLDGVL    211 - 280
EVRNEHFWTLGFGSLAGSVHVRIRRDANEQMVLAHVTNRLYTLVSTLTVQIFKDDWIRPALLSGPVAANV    281 - 350
LNFSDHHVIPMPLLKGTDDLNPVTSTPAKPSSPPPEFSFNTPGKNVNPVILLNTQTRPYGFGLNHGHTPY    351 - 420
SSMLNQGLGVPGIGATQGLRTGFTNIPSRYGTNNRIGQPRP                                 421 - 461
//

Text Mined References (24)

PMID Year Title