Property Summary

NCBI Gene PubMed Count 8
PubMed Score 10.90
PubTator Score 11.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.300 0.005
acute myeloid leukemia 1.300 0.005

Synonym

Accession Q6NXT2 E9P281
Symbols H3.5

Gene

PDB

3KV4   4Z5T   5F6K   5BWO   5I3L  

Gene RIF (1)

PMID Text
21274551 H3.5 preferentially colocalizes with euchromatin, and it is associated with actively transcribed genes and can replace an essential function of RNAi-depleted H3.3 in cell growth.

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGVKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRL      1 - 70
VREIAQDFNTDLRFQSAAVGALQEASEAYLVGLLEDTNLCAIHAKRVTIMPKDIQLARRIRGERA          71 - 135
//

Text Mined References (9)

PMID Year Title
26779285 2016 Histone H3.5 forms an unstable nucleosome and accumulates around transcription start sites in human testis.
25416956 2014 A proteome-scale map of the human interactome network.
25362550 2015 A comprehensive view of the epigenetic landscape part I: DNA methylation, passive and active DNA demethylation pathways and histone variants.
21274551 2011 H3.5 is a novel hominid-specific histone H3 variant that is specifically expressed in the seminiferous tubules of human testes.
20850016 2010 Quantitative interaction proteomics and genome-wide profiling of epigenetic histone marks and their readers.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.