Property Summary

NCBI Gene PubMed Count 8
PubMed Score 12.40
PubTator Score 11.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
diabetes mellitus 1728 5.1e-03
acute myeloid leukemia 783 5.3e-03
Disease Target Count Z-score Confidence
Giant cell tumor 5 3.036 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
acute myeloid leukemia 1.300 5.3e-03
diabetes mellitus -1.300 5.1e-03

Gene RIF (1)

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSTPSTCGVKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRL      1 - 70
VREIAQDFNTDLRFQSAAVGALQEASEAYLVGLLEDTNLCAIHAKRVTIMPKDIQLARRIRGERA          71 - 135
//

Text Mined References (9)

PMID Year Title