Property Summary

NCBI Gene PubMed Count 8
PubMed Score 25.57
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Gene RIF (1)

PMID Text
23506001 PPP1R2P3 protein binds directly to PPP1CC and that this inhibitor cannot be phosphorylated by GSK3.

AA Sequence

MAASTASHRPIKGILKNKTSTTSSMVASAEQPRRSVDEELSKKSQKWDEINILATYHPADKGYGLMKIDE      1 - 70
PSPPYHSMMGDDEDACRDTETTEAMAPGILAKKLAAAEGLEPKYRIQEQESSGEEDSDLSPEEREKKRQF     71 - 140
EMRRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNKLRSS         141 - 205
//

Text Mined References (8)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24195737 2013 Not so pseudo: the evolutionary history of protein phosphatase 1 regulatory subunit 2 and related pseudogenes.
23506001 2013 Identification and characterization of two distinct PPP1R2 isoforms in human spermatozoa.
21382349 2011 Identification of the human testis protein phosphatase 1 interactome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11948623 2002 Regulator-driven functional diversification of protein phosphatase-1 in eukaryotic evolution.
7949733 1994 Cloning and characterization of human phosphatase inhibitor-2 (IPP-2) sequences.