Property Summary

NCBI Gene PubMed Count 8
PubMed Score 26.25
PubTator Score 0.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Congenital stationary night blindness 29 3.226 1.6

Gene RIF (1)

AA Sequence

MAASTASHRPIKGILKNKTSTTSSMVASAEQPRRSVDEELSKKSQKWDEINILATYHPADKGYGLMKIDE      1 - 70
PSPPYHSMMGDDEDACRDTETTEAMAPGILAKKLAAAEGLEPKYRIQEQESSGEEDSDLSPEEREKKRQF     71 - 140
EMRRKLHYNEGLNIKLARQLISKDLHDDDEDEEMLETADGESMNTEESNQGSTPSDQQQNKLRSS         141 - 205
//

Text Mined References (8)

PMID Year Title