Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.12
PubTator Score 4.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 4.1e-08
group 3 medulloblastoma 4104 2.4e-05
psoriasis 6694 3.4e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.700 2.4e-05
osteosarcoma -2.059 4.1e-08
psoriasis -1.300 3.4e-04

Synonym

Accession Q6NXR4 D3DSV7 Q96IM2 Q9H5N4
Symbols MRT39
C8orf41

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MELDSALEAPSQEDSNLSEELSHSAFGQAFSKILHCLARPEARRGNVKDAVLKDLGDLIEATEFDRLFEG      1 - 70
TGARLRGMPETLGQVAKALEKYAAPSKEEEGGGDGHSEAAEKAAQVGLLFLKLLGKVETAKNSLVGPAWQ     71 - 140
TGLHHLAGPVYIFAITHSLEQPWTTPRSREVAREVLTSLLQVTECGSVAGFLHGENEDEKGRLSVILGLL    141 - 210
KPDLYKESWKNNPAIKHVFSWTLQQVTRPWLSQHLERVLPASLVISDDYQTENKILGVHCLHHIVLNVPA    211 - 280
ADLLQYNRAQVLYHAISNHLYTPEHHLIQAVLLCLLDLFPILEKTLHWKGDGARPTTHCDEVLRLILTHM    281 - 350
EPEHRLLLRRTYARNLPAFVNRLGILTVRHLKRLERVIIGYLEVYDGPEEEARLKILETLKLLMQHTWPR    351 - 420
VSCRLVVLLKALLKLICDVARDPNLTPESVKSALLQEATDCLILLDRCSQGRVKGLLAKIPQSCEDRKVV    421 - 490
NYIRKVQQVSEGAPYNGT                                                        491 - 508
//

Text Mined References (10)

PMID Year Title