Property Summary

NCBI Gene PubMed Count 2
Grant Count 19
R01 Count 10
Funding $3,427,115.5
PubMed Score 471.61
PubTator Score 8.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATSKLPVVPGEEENTILMAKERLEALRTAFESGDLPQAASHLQELLASTESIRLEVGVTGESGAGKSSL      1 - 70
INALRGLEAEDPGAALTGVMETTMQPSPYPHPQFPDVTLWDLPGAGSPGCPADKYLKQVDFSRYDFFLLV     71 - 140
SPRRCGAVETRLAAEILCQGKKFYFVRTKVDEDLAATRTQRPSGFREAAVLQEIRDHCAERLREAGVADP    141 - 210
RIFLVSNLSPARYDFPTLVSTWEHDLPSHRRHAGLLSLPDISLEALQKKKAMLQEQVLKTALVLGVIQAL    211 - 280
PVPGLAAAYDDALLIHSLRGYHRSFGLDDDSLAKLAEQVGKQAGDLRSVIRSPLANEVSPETVLRLYSQS    281 - 350
SDGAMRVARAFERGIPVFGTLVAGGISFGAVYTMLQGCLNEMAEDAQRVRIKALEDDEPQPEVSLEVASD    351 - 420
NGVEKGGSGEGGGEEAPLSTCRKLGLLLKYILDSWKKHDSEEK                               421 - 463
//

Text Mined References (4)

PMID Year Title
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.