Property Summary

NCBI Gene PubMed Count 2
PubMed Score 502.77
PubTator Score 8.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

AA Sequence

MATSKLPVVPGEEENTILMAKERLEALRTAFESGDLPQAASHLQELLASTESIRLEVGVTGESGAGKSSL      1 - 70
INALRGLEAEDPGAALTGVMETTMQPSPYPHPQFPDVTLWDLPGAGSPGCPADKYLKQVDFSRYDFFLLV     71 - 140
SPRRCGAVETRLAAEILCQGKKFYFVRTKVDEDLAATRTQRPSGFREAAVLQEIRDHCAERLREAGVADP    141 - 210
RIFLVSNLSPARYDFPTLVSTWEHDLPSHRRHAGLLSLPDISLEALQKKKAMLQEQVLKTALVLGVIQAL    211 - 280
PVPGLAAAYDDALLIHSLRGYHRSFGLDDDSLAKLAEQVGKQAGDLRSVIRSPLANEVSPETVLRLYSQS    281 - 350
SDGAMRVARAFERGIPVFGTLVAGGISFGAVYTMLQGCLNEMAEDAQRVRIKALEDDEPQPEVSLEVASD    351 - 420
NGVEKGGSGEGGGEEAPLSTCRKLGLLLKYILDSWKKHDSEEK                               421 - 463
//

Text Mined References (4)

PMID Year Title