Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6NXP6 B3KQ47 O95435
Symbols C14orf148

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MDMLQDLESLQFEYGVPEEDRIWLYLQGRSRGLMIEACAHATFFCKLLYNLRASLNKNQSSRHLSIGSLN      1 - 70
SATPEEFKVGIIGGGHLGKQLAGTLLQLGPIPAESLRISTRRPETLGELQKLGIKCFYHNADLVSWADVI     71 - 140
FLCCLPSQLPNICVEIYTSLEKASIVYSFVAAIPLPRLKLLLNHTNILRPQYQYDEDSVSVWGANKGVIA    141 - 210
ALQDPTILQATCPYSPAGGIILNIKWLEGVFYAALNICTARNMAHSQVLQLLSELFLSVHFEDCGKDTAS    211 - 280
CPKLQLTDFVSKAYGKNLSQERPFPWFDLTAVQLKETPFSQHLSSSPVLQDHLTHLYCASFGISLTKEQP    281 - 350
VISTGFPSQ                                                                 351 - 359
//

Text Mined References (6)

PMID Year Title