Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Seminoma 15 4.172 2.1
Testicular cancer 25 3.979 2.0

Expression

Synonym

Accession Q6NXP2 Q0VGF6 Q0VGF7 Q86X39
Symbols FAM137B

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (1)

AA Sequence

MSKIRGLPPEVREPGPGVELGVENGLLCQLIHSPEFNLFSNSVVFESNFIQTHVPEADFQVTKPGNWRDV      1 - 70
CEGSATVILGVTSSVPSLPLPNVLLMANVTWPQGPFTTWSTPGDAPVINLSRLLPLKYVELRIYDRLQRI     71 - 140
LRVRTVTEKIYYLKLHEKHPEIVFQFWVRLVKILQKGLSITTKDPRIKFTHCLVPKMPTNSTETTPENSL    141 - 210
LSSPQPSEPLVLLAAEQTSGSFSQLSGKPQLTADRNNDTAIEIDNCSSYKIPSPVASPINLNIPMRAALS    211 - 280
HSLWEQEDWNEHLLQVHIASYLGEHFLGA                                             281 - 309
//

Text Mined References (5)

PMID Year Title