Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group B ependymoma 1530 2.15572393794931E-12
osteosarcoma 7933 6.66591546409646E-6
chronic rhinosinusitis 512 0.0386934779060988

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.034 0.000
posterior fossa group B ependymoma 3.300 0.000
chronic rhinosinusitis -1.127 0.039

Synonym

Accession Q6NXP0 Q69YX4
Symbols C3orf25

Gene

  Ortholog (6)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Rat OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

 GO Function (1)

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18976975 Knockdown of chromosome 3 open reading frame 25 (C3orf25) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MDDDYEAYHSLFLSLLGLCPSKTPINENAPVFDPEPVIAHCFKQFQQKDFRLPQTRRRIIMVPRKEDQTP      1 - 70
LNPASQPQAPPKPIPSFKVLEARDIQEQPEDRKTWLSQRSKLRQELESFGDVKRWLENKPSITPSEAKVL     71 - 140
HMIHEEQSAQPNASQATTRTTRKKAPRLSRLSRQMVPQLQLPEPPALSVMYSYLHSRKIKILEIFHKVGQ    141 - 210
GENQRITREEFIAAVKAVGVPLKNQEVEDIVIYLSSLGKHNTITMDILANTYKQWSMAQQRSSLATAREH    211 - 280
YILAKHRDSLKGPLKKQEVDSAPQLPKVDLLTVPAVDTQMETRPMTLEEMEEVGKRYRERQRQHKLTIPS    281 - 350
IQYTEQCHLVRCGNRHFDEHCLPSTIHGDMRELIDSARRHNFLVYLQCWKLCKSYGLPLTEDILMKALLY    351 - 420
PGDKIIFQMDKVCPIRQPGGYYSDWKVFSPNLALLRSQGPGKSKRTDKKTPKKSKKMRFKEFEEFTRKLK    421 - 490
VKRSSGLQQTHPNSFWPGHLLDKLQLYLPTVATDRSLALFSCVQHQPHVYPATYHPDHWWPLRNKNYMTH    491 - 560
AHYDAAKVYYIN                                                              561 - 572
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.