Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

AA Sequence

MKKQGVNPKPLQSSRPSPSKRPYGASPARELEVEKSALGGGKLPGGARRSSPGRIPNLKKRKGLELKVVA      1 - 70
KTLLDPFQFVRNSLAQLREEVHELQARWFPSRTTLSIAIFVAILHWLHLVTLFENDRHFSHLSSLEWEMT     71 - 140
FRTKMGLYYSYFKTIIEAPSFLEGLWMIMNDRLTEYPLVINTVKRFHLYPEVIIAAWYRTFIGIMNLFGL    141 - 210
ETKTCWNVTRIEPLNEFKAVKDWEILLAFMLV                                          211 - 242
//

Text Mined References (3)

PMID Year Title
16526957 2006 Duplication and relocation of the functional DPY19L2 gene within low copy repeats.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.