Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
mucosa-associated lymphoid tissue lymphoma 484 9.4e-03

AA Sequence

MKKQGVNPKPLQSSRPSPSKRPYGASPARELEVEKSALGGGKLPGGARRSSPGRIPNLKKRKGLELKVVA      1 - 70
KTLLDPFQFVRNSLAQLREEVHELQARWFPSRTTLSIAIFVAILHWLHLVTLFENDRHFSHLSSLEWEMT     71 - 140
FRTKMGLYYSYFKTIIEAPSFLEGLWMIMNDRLTEYPLVINTVKRFHLYPEVIIAAWYRTFIGIMNLFGL    141 - 210
ETKTCWNVTRIEPLNEFKAVKDWEILLAFMLV                                          211 - 242
//

Text Mined References (3)

PMID Year Title