Property Summary

NCBI Gene PubMed Count 21
Grant Count 33
R01 Count 18
Funding $1,816,520.21
PubMed Score 37.40
PubTator Score 21.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (15)

PMID Text
26522352 MCL1 with the deletion of 801G and 802A sites could not be correctly spliced by ESRP1 and no significant difference was seen in the expressions of isoform 1 and 3 in mutant MCL1
25143390 ESRP1 and ESRP2 suppress cancer cell motility via different mechanisms.
24077287 Results show that ESRP1 regulates the expression pattern of FGFR-2 isoforms, attenuates cell growth, migration, invasion and metastasis, and is a favorable prognostic factor in pancreatic ductal adenocarcinoma.
23825128 Data suggest that alternative splicing in ESRP1 transcripts in somatotroph adenomas is essential in epithelial-mesenchymal transition progression and in response to somatostatin analog antineoplastic treatment.
23299472 ESRP1 and PNN modulate alternative splicing of a specific subset of target genes, but not general splicing events, in HCET cells to maintain or enhance epithelial characteristics.
22961986 the transcription repressor Snail binds to E-boxes in the ESRP1 promoter, causing repression of the ESRP1 gene.
22585092 ESRP1 could be a master regulator of the EMT process in pituitary adenomas causing acromegaly.
22354987 functions of the ESRP1 in an epithelial posttranscriptional gene expression program.
22037216 deltaEF1 family proteins repress the expression of ESRPs to regulate alternative splicing during TGF-beta-induced EMT and the progression of breast cancers
21876675 The functional significance of EMT-associated alternative splicing was tested by expression of the epithelial-specific splicing factor ESRP1
More...

AA Sequence

MTASPDYLVVLFGITAGATGAKLGSDEKELILLFWKVVDLANKKVGQLHEVLVRPDQLELTEDCKEETKI      1 - 70
DVESLSSASQLDQALRQFNQSVSNELNIGVGTSFCLCTDGQLHVRQILHPEASKKNVLLPECFYSFFDLR     71 - 140
KEFKKCCPGSPDIDKLDVATMTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF    141 - 210
ESGTCSKMELIDDNTVVRARGLPWQSSDQDIARFFKGLNIAKGGAALCLNAQGRRNGEALVRFVSEEHRD    211 - 280
LALQRHKHHMGTRYIEVYKATGEDFLKIAGGTSNEVAQFLSKENQVIVRMRGLPFTATAEEVVAFFGQHC    281 - 350
PITGGKEGILFVTYPDGRPTGDAFVLFACEEYAQNALRKHKDLLGKRYIELFRSTAAEVQQVLNRFSSAP    351 - 420
LIPLPTPPIIPVLPQQFVPPTNVRDCIRLRGLPYAATIEDILDFLGEFATDIRTHGVHMVLNHQGRPSGD    421 - 490
AFIQMKSADRAFMAAQKCHKKNMKDRYVEVFQCSAEEMNFVLMGGTLNRNGLSPPPCKLPCLSPPSYTFP    491 - 560
APAAVIPTEAAIYQPSVILNPRALQPSTAYYPAGTQLFMNYTAYYPSPPGSPNSLGYFPTAANLSGVPPQ    561 - 630
PGTVVRMQGLAYNTGVKEILNFFQGYQYATEDGLIHTNDQARTLPKEWVCI                       631 - 681
//

Text Mined References (24)

PMID Year Title
26522352 2015 [The myeloid cell leukemia-1 mRNA splicing mediated by epithelial splicing regulatory protein 1 (ESRP1) in glioma U251 cell lines].
25416956 2014 A proteome-scale map of the human interactome network.
25143390 2014 Epithelial splicing regulatory proteins 1 (ESRP1) and 2 (ESRP2) suppress cancer cell motility via different mechanisms.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24077287 2014 Epithelial splicing regulatory protein 1 is a favorable prognostic factor in pancreatic cancer that attenuates pancreatic metastases.
23825128 2013 Epithelial splicing regulator protein 1 and alternative splicing in somatotroph adenomas.
23299472 2013 Transcriptomic analysis of PNN- and ESRP1-regulated alternative pre-mRNA splicing in human corneal epithelial cells.
22961986 2012 Snail represses the splicing regulator epithelial splicing regulatory protein 1 to promote epithelial-mesenchymal transition.
22585092 2012 Gene expression profiling identifies ESRP1 as a potential regulator of epithelial mesenchymal transition in somatotroph adenomas from a large cohort of patients with acromegaly.
22354987 2012 Genome-wide determination of a broad ESRP-regulated posttranscriptional network by high-throughput sequencing.
More...