Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
Funding $157,851.01
PubMed Score 108.17
PubTator Score 29.53

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q6NW40 D6R9A0 Q8NC92
Symbols DRAGON

Gene

PDB

4UHZ   4UI0   4UI2   4BQ6   4BQ7   4BQ8  

Gene RIF (7)

PMID Text
26055877 RGMB was down-regulation in non-small cell lung cancer.
26029998 Data show that Dragon expression was increased in colon cancer tissues compared to control tissues in CAC mouse model and in human patients.
24970050 Study highlights the potential importance of RGMb in propagating pro-angiogenic effects of HGF and BMP-7.
23744777 two RGMB ectodomains conformationally stabilize the juxtamembrane regions of two NEO1 receptors in a pH-dependent manner.
22415859 current data firstly revealed that RGMB may act as a negative regulator in breast cancer through BMP signaling
22076499 The expression of RGMA, RGMB and RGMC was evident in most examined prostate cancer cell lines, and also in the prostate cancer tissues
21617229 Reduced expression of RGMB in breast cancer was associated with breast cancer.

AA Sequence

MGLRAAPSSAAAAAAEVEQRRSPGLCPPPLELLLLLLFSLGLLHAGDCQQPAQCRIQKCTTDFVSLTSHL      1 - 70
NSAVDGFDSEFCKALRAYAGCTQRTSKACRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNPEVTHDPCN     71 - 140
YHSHAGAREHRRGDQNPPSYLFCGLFGDPHLRTFKDNFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSA    141 - 210
TATNKITIIFKAHHECTDQKVYQAVTDDLPAAFVDGTTSGGDSDAKSLRIVERESGHYVEMHARYIGTTV    211 - 280
FVRQVGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPLSERIDDGQGQVSAILGHSLPRTSLVQAWPGYT    281 - 350
LETANTQCHEKMPVKDIYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPRKERWHIFPSSGNGTPRGGS    351 - 420
DLSVSLGLTCLILIVFL                                                         421 - 437
//

Text Mined References (16)

PMID Year Title
26055877 2015 Study on expression of lncRNA RGMB-AS1 and repulsive guidance molecule b in non-small cell lung cancer.
26029998 2015 Dragon (repulsive guidance molecule b, RGMb) is a novel gene that promotes colorectal cancer growth.
24970050 2014 Tumour angiogenesis and repulsive guidance molecule b: a role in HGF- and BMP-7-mediated angiogenesis.
24236485 2013 Genome-wide association study in NSAID-induced acute urticaria/angioedema in Spanish and Han Chinese populations.
23744777 2013 Structure of the repulsive guidance molecule (RGM)-neogenin signaling hub.
22415859 2012 Repulsive guidance molecule B (RGMB) plays negative roles in breast cancer by coordinating BMP signaling.
22076499 2012 Repulsive guidance molecules, novel bone morphogenetic protein co-receptors, are key regulators of the growth and aggressiveness of prostate cancer cells.
21617229 2011 Potential prognostic value of repulsive guidance molecules in breast cancer.
21182207 2010 Variants in several genomic regions associated with asperger disorder.
19324014 2009 Repulsive guidance molecule b inhibits neurite growth and is increased after spinal cord injury.
More...