Property Summary

NCBI Gene PubMed Count 17
PubMed Score 117.95
PubTator Score 29.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 2.0e-02
Atopic dermatitis -1.100 6.6e-03
atypical teratoid / rhabdoid tumor 1.100 1.2e-02
cystic fibrosis 1.149 1.7e-03
ependymoma -1.100 1.3e-05
gastric carcinoma -1.600 1.5e-02
group 3 medulloblastoma 1.300 3.9e-02
Hydrolethalus syndrome 2.222 2.0e-02
interstitial cystitis -1.200 3.8e-02
intraductal papillary-mucinous neoplasm ... -1.100 2.9e-02
lung carcinoma 1.100 5.0e-16
oligodendroglioma 1.800 1.7e-02
psoriasis -1.500 4.7e-22
X-linked cerebral adrenoleukodystrophy -1.500 2.2e-02

Gene RIF (8)

AA Sequence

MGLRAAPSSAAAAAAEVEQRRSPGLCPPPLELLLLLLFSLGLLHAGDCQQPAQCRIQKCTTDFVSLTSHL      1 - 70
NSAVDGFDSEFCKALRAYAGCTQRTSKACRGNLVYHSAVLGISDLMSQRNCSKDGPTSSTNPEVTHDPCN     71 - 140
YHSHAGAREHRRGDQNPPSYLFCGLFGDPHLRTFKDNFQTCKVEGAWPLIDNNYLSVQVTNVPVVPGSSA    141 - 210
TATNKITIIFKAHHECTDQKVYQAVTDDLPAAFVDGTTSGGDSDAKSLRIVERESGHYVEMHARYIGTTV    211 - 280
FVRQVGRYLTLAIRMPEDLAMSYEESQDLQLCVNGCPLSERIDDGQGQVSAILGHSLPRTSLVQAWPGYT    281 - 350
LETANTQCHEKMPVKDIYFQSCVFDLLTTGDANFTAAAHSALEDVEALHPRKERWHIFPSSGNGTPRGGS    351 - 420
DLSVSLGLTCLILIVFL                                                         421 - 437
//

Text Mined References (18)

PMID Year Title