Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.40
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 3.2e-04
group 3 medulloblastoma 4104 2.7e-03
osteosarcoma 7950 1.2e-02

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma 1.100 2.7e-03
osteosarcoma -1.064 1.2e-02
ovarian cancer -1.100 3.2e-04

AA Sequence

MSANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENGDPKAFLIEISWTETYPQTPPILSMNAFFNN      1 - 70
TISSAVKQSILAKLQEAVEANLGTAMTYTLFEYAKDNKEQFMENHNPINSATSISNIISIETPNTAPSSK     71 - 140
KKDKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLSKTGSKDDE                          141 - 188
//

Text Mined References (10)

PMID Year Title