Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q6NVV9 A8MW71 Q4G196
Symbols ADAM5P
TMDCII

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
25776870 ADAM5, or nearby regulatory elements, may be involved in the etiology of oral clefts.

AA Sequence

MQTSILIKSSCRPQFQRRFHHRMQKQIQNIISILSSASVINSYDENDIRHSKPLLVQMDCNYNGYVAGIP      1 - 70
NSLVTLSVCSGLRGTMQLKNISYGIEPMEAVSGFIHKIYEEKYADTNILLEENDTYTWFNSEYQVRKSSE     71 - 140
KTDFIKLFPRYIEMHIVVDKNLFKPANMICRKSVGKECDFTEYCNGDLPYCLPDTYVRDGEYCDSGGAFC    141 - 210
FQGKCRTFDKQCDDLIGRGSRGAPVFCYDEINTRGDNFGNCGTAHCLFQHILCGKLVCTWEHRDLISRPN    211 - 280
LSVIYAHVRDQTCVSTYLPRRTPPPVNSPISITSYYSAEDRDETFVQDGSMCGPDMYCFEMHCKHVRFLM    281 - 350
NLKLCDASNHCDRHGVCNNFNHCHCEKGYNPPYCQPKQGAFGSIDDGHLVPPTERSYMEEGR            351 - 412
//

Text Mined References (7)

PMID Year Title
25776870 2015 A genome-wide study of inherited deletions identified two regions associated with nonsyndromic isolated oral clefts.
20210993 2010 Identification and analysis of unitary pseudogenes: historic and contemporary gene losses in humans and other primates.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10417343 1999 Transcripts encoding the sperm surface protein tMDC II are non-functional in the human.
8786143 1996 Chromosomal assignment of four testis-expressed mouse genes from a new family of transmembrane proteins (ADAMs) involved in cell-cell adhesion and fusion.