Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Gout 104 3.723 1.9

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis -1.900 3.4e-03
intraductal papillary-mucinous adenoma (... 1.200 4.6e-03
ulcerative colitis -1.500 4.4e-05

Gene RIF (1)

AA Sequence

MGAQVRLPPGEPCREGYVLSLVCPNSSQAWCEITNVSQLLASPVLYTDLNYSINNLSISANVENKYSLYV      1 - 70
GLVLAVSSSIFIGSSFILKKKGLLQLASKGFTRAGQGGHSYLKEWLWWVGLLSMGAGEAANFAAYAFAPA     71 - 140
TLVTPLGALSVLISAILSSYFLNEHLNIHGKIGCILSILGSTVMVIHAPQEEEVTSLHEMEMKLRDPGFI    141 - 210
SFAVIITVISLVLILIVAPKKGQTNILVYISICSLIGAFSVSSVKGLGIAIKELIEWKPVYKHPLVFVLL    211 - 280
AVLVLSVTTQINYLNKALDTFNTSLVTPIYYVFFTSMVVTCSAILFQEWYGMTAGDIIGTLSGFFTIIIG    281 - 350
IFLLHAFKNTDITWSELTSTAKKEAVSLNVNENNYVLLENLECSAPGYNDDVTLFSRTDD              351 - 410
//

Text Mined References (5)

PMID Year Title