Property Summary

NCBI Gene PubMed Count 5
Grant Count 91
R01 Count 21
Funding $19,958,146.27
PubMed Score 63.24

Knowledge Summary

Patent

No data available

Synonym

Accession Q6NVV1
Symbols RPL13A_11_1370

Gene

 GO Process (1)

AA Sequence

MLRHKTKRGHASLDCLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFALLGRQAQEVRWKYQAVTATL      1 - 70
EEKRKEKAKIHYWKKKQLMRLRKQAEKNVKKN                                           71 - 102
//

Text Mined References (6)

PMID Year Title
23648065 2013 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21630459 2011 Proteomic characterization of the human sperm nucleus.
19123937 2009 Comparative analysis of processed ribosomal protein pseudogenes in four mammalian genomes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.