Property Summary

NCBI Gene PubMed Count 5
PubMed Score 64.37

Knowledge Summary

Patent

No data available

AA Sequence

MLRHKTKRGHASLDCLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFALLGRQAQEVRWKYQAVTATL      1 - 70
EEKRKEKAKIHYWKKKQLMRLRKQAEKNVKKN                                           71 - 102
//

Text Mined References (6)

PMID Year Title